KEGG   Ralstonia pickettii 12D: Rpic12D_3542Help
Entry
Rpic12D_3542      CDS       T00925                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00362  Benzoate degradation
rpf00620  Pyruvate metabolism
rpf00621  Dioxin degradation
rpf00622  Xylene degradation
rpf00650  Butanoate metabolism
rpf01100  Metabolic pathways
rpf01120  Microbial metabolism in diverse environments
rpf01220  Degradation of aromatic compounds
Module
rpf_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic12D_3542
   00650 Butanoate metabolism
    Rpic12D_3542
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic12D_3542
   00622 Xylene degradation
    Rpic12D_3542
   00621 Dioxin degradation
    Rpic12D_3542
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rpic12D_3542
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Rpic12D_3542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACS64802
JGI: Rpic12D_3542
UniProt: C6BL44
Position
2:complement(87838..88773)
Genome map
AA seq 311 aa AA seqDB search
MTQKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPESDGLRRAREMGIKTTAEGVD
GLLPHVLADGVQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPYCVPPVNLKEHLG
RAEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSRSVGPGTRKNIDEFTRTTAG
AVERVGGAKKGKAIIVINPAEPPLIMRDTVHCLTETEPDQAAITASIQAMIKEVQKYVPG
YKLVNGPVFDGNRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEMIKGELNLR
AGTAASATETA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaagatcaaatgcgccctgatcggccccggcaacatcggcaccgatctgctg
gccaagctgcagcgcagccccgtgctggaaccggtatggatggtgggcatcgatcccgaa
tccgacggcctcaggcgtgcgcgcgagatgggcatcaagaccaccgccgaaggcgtggac
ggcctgctgccccacgtgttggccgacggcgtgcagattgccttcgatgccaccagcgcc
tacgtgcatgccgagaactcacgcaagctcaacgcgctgggcgtgctgatgatcgacctc
acacctgcggccatcggcccgtactgcgtgccgccggtcaacctcaaggagcatctgggc
cgcgcagagatgaacgtcaacatggtgacctgcggcgggcaagcgaccatcccgatggtg
gcggcagtcagccgcgtgcagcccgtggcgtatggcgagatcgttgccacggtgtcgagc
cggtcggtggggccgggcacccgcaagaacattgatgaattcacgcgtaccacggccggt
gcggtcgagcgtgtgggcggagcgaagaagggcaaggccatcatcgtcatcaacccggct
gagccgccgctgatcatgcgcgacaccgtgcattgcctgacggaaaccgagccggatcag
gcggccatcaccgcgtcgatccaggcgatgatcaaagaggtgcagaagtacgtgccgggc
tacaagctcgtcaacggcccggtgttcgacggcaaccgcgtgagcgtgttcctggaggtc
gagggcctgggcgattacctgcccaagtacgccggcaacctcgacatcatgaccgccgca
gccgcgcgcacggccgagatgtttgccgaggagatgatcaagggcgaactgaacctgcgc
gccggcacggccgcgtctgccactgaaaccgcctga

DBGET integrated database retrieval system