KEGG   Ralstonia pickettii 12D: Rpic12D_3542Help
Entry
Rpic12D_3542      CDS       T00925                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpf00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rpf00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:rpf00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:rpf00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:rpf00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(87838..88773)
Genome map
AA seq 311 aa AA seqDB search
MTQKIKCALIGPGNIGTDLLAKLQRSPVLEPVWMVGIDPESDGLRRAREMGIKTTAEGVD
GLLPHVLADGVQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPYCVPPVNLKEHLG
RAEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSRSVGPGTRKNIDEFTRTTAG
AVERVGGAKKGKAIIVINPAEPPLIMRDTVHCLTETEPDQAAITASIQAMIKEVQKYVPG
YKLVNGPVFDGNRVSVFLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEMIKGELNLR
AGTAASATETA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaagatcaaatgcgccctgatcggccccggcaacatcggcaccgatctgctg
gccaagctgcagcgcagccccgtgctggaaccggtatggatggtgggcatcgatcccgaa
tccgacggcctcaggcgtgcgcgcgagatgggcatcaagaccaccgccgaaggcgtggac
ggcctgctgccccacgtgttggccgacggcgtgcagattgccttcgatgccaccagcgcc
tacgtgcatgccgagaactcacgcaagctcaacgcgctgggcgtgctgatgatcgacctc
acacctgcggccatcggcccgtactgcgtgccgccggtcaacctcaaggagcatctgggc
cgcgcagagatgaacgtcaacatggtgacctgcggcgggcaagcgaccatcccgatggtg
gcggcagtcagccgcgtgcagcccgtggcgtatggcgagatcgttgccacggtgtcgagc
cggtcggtggggccgggcacccgcaagaacattgatgaattcacgcgtaccacggccggt
gcggtcgagcgtgtgggcggagcgaagaagggcaaggccatcatcgtcatcaacccggct
gagccgccgctgatcatgcgcgacaccgtgcattgcctgacggaaaccgagccggatcag
gcggccatcaccgcgtcgatccaggcgatgatcaaagaggtgcagaagtacgtgccgggc
tacaagctcgtcaacggcccggtgttcgacggcaaccgcgtgagcgtgttcctggaggtc
gagggcctgggcgattacctgcccaagtacgccggcaacctcgacatcatgaccgccgca
gccgcgcgcacggccgagatgtttgccgaggagatgatcaagggcgaactgaacctgcgc
gccggcacggccgcgtctgccactgaaaccgcctga

DBGET integrated database retrieval system