KEGG   Ralstonia pickettii 12D: Rpic12D_3788Help
Entry
Rpic12D_3788      CDS       T00925                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00010  Glycolysis / Gluconeogenesis
rpf00052  Galactose metabolism
rpf00500  Starch and sucrose metabolism
rpf00520  Amino sugar and nucleotide sugar metabolism
rpf00521  Streptomycin biosynthesis
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
Module
rpf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_3788
   00052 Galactose metabolism
    Rpic12D_3788
   00500 Starch and sucrose metabolism
    Rpic12D_3788
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic12D_3788
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpic12D_3788
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rpic12D_3788
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rpic12D_3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACS65047
JGI: Rpic12D_3788
UniProt: C6BLT9
Position
2:complement(354020..355075)
Genome map
AA seq 351 aa AA seqDB search
MSIGLHEVNAGTDADVTAYPRLVADVGGTNVRFALEMAPMRLAHIGVLAGDDYPSLESAM
RAYLASLPPEIASAGVRHAAIGIANPVLGDQIRMTNRDWAFSIEAMRQSLGFDTFVVIND
FAALAHALPYLPADELEQVGGDASLADAPRALLGAGTGLGVASLLPTPDGRYIAVAGEGG
HVAFPPMNDEEVAIWRFARERFGHVSAERLISGMGLELIYEALGACFDLWQQGPAVRRAA
DITAIALGEMEDAAGDHARCRYAVDTFCAFLGTIAANLAVTLGARGGVYIGGGIVPRLGP
AFANSPFRRRFEDKGRFSSYVAAMPVYVIHSPYPGLIGLCAAMDHAVAQGH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctattggactgcatgaagtgaacgcgggcactgacgcagatgtcacggcctacccg
cgcctggtggccgacgtgggcggcaccaacgtgcgcttcgcgctcgagatggcgccgatg
cgccttgcgcacatcggtgtgctggccggcgacgattatccatcgctcgaatccgccatg
cgtgcgtatctggcgtcgctgccgcccgagattgcgtcggccggcgtgcgccatgcggcc
atcggtatcgccaatccggtgctgggcgaccagatccgcatgaccaaccgcgactgggcc
ttctcgattgaagcgatgcggcagtcgctgggtttcgacaccttcgtcgtgatcaacgac
tttgccgcactggcccatgcactgccgtacctgccggccgatgagctggaacaggtgggt
ggcgacgccagccttgccgatgcgccgcgcgccctgctcggcgcgggcacgggcctgggc
gtggcctcgctgctgccgacgcccgacggccgctacatcgccgtcgcgggcgagggcggc
cacgtggccttcccgcccatgaatgacgaggaagtggccatctggcgctttgcgcgcgag
cgctttggccacgtctctgcggagcggctcatctcgggcatggggctggaattgatctac
gaggcgctgggtgcgtgcttcgacttgtggcagcaaggcccggccgtacggcgcgccgcc
gacatcaccgccattgcgctcggcgagatggaagatgcggcaggcgatcatgcgcgctgc
cgctacgccgtcgatacgttctgcgcttttctcggcaccatcgcagccaacctggccgtg
acgctgggtgcgcgcggtggcgtgtacatcggcggggggatcgtcccaaggcttggcccg
gcgttcgccaactcgccgttccggcggcgctttgaagacaagggccgcttctcgtcctat
gtagcggcgatgccggtgtatgtcatccactcgccatacccggggctgatcggcctgtgc
gcggcgatggaccacgcggtggcacaggggcattga

DBGET integrated database retrieval system