KEGG   Ralstonia pickettii 12D: Rpic12D_3793Help
Entry
Rpic12D_3793      CDS       T00925                                 

Definition
hypothetical protein
Organism
rpf  Ralstonia pickettii 12D
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:359981..360448
Genome map
AA seq 155 aa AA seqDB search
MHRHPPAPTAELIAAYRSARYRVETPQGDVLLHLDAVNPCVAALLAQADARWAVFVTAYQ
PFSRPVSAEENATRQAELLAWAIARGMPWLYGEGGAPEAASASMAEAWAPEPSVLLFTDD
PATADTLMLTFDQNAVVLCDAQGFCTLRWHPYLPD
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtcatccgcccgcgcccaccgccgagttgatcgccgcctaccgtagcgcacgg
taccgcgtggaaacgccgcagggcgatgtgctgctgcacctcgatgccgtcaacccgtgc
gtggcggcgctgctcgcgcaggccgatgcgcggtgggccgtgttcgtgacggcgtaccag
ccgttctcacggccggtctctgcagaagagaacgccacgcggcaggcggaactgctggcc
tgggccatcgcgcgaggcatgccatggctgtacggcgagggcggcgcgcctgaagccgcc
tctgccagcatggccgaggcgtgggcgccagagcccagcgtcctgctgttcaccgatgac
cctgccaccgccgacaccctcatgctgaccttcgatcagaacgctgtcgtgctgtgcgac
gcgcagggtttttgcaccttgcgttggcatccgtatctgccagactga

DBGET integrated database retrieval system