KEGG   Ralstonia pickettii 12D: Rpic12D_3899Help
Entry
Rpic12D_3899      CDS       T00925                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rpic12D_3899
   00052 Galactose metabolism
    Rpic12D_3899
   00500 Starch and sucrose metabolism
    Rpic12D_3899
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic12D_3899
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rpic12D_3899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:471882..472835
Genome map
AA seq 317 aa AA seqDB search
MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGR
AKRAIEDHFDKAYELETELAAKNKQALLDMVQSIKPAGVECFYVRQPETLGLGHAVLCAQ
KLVRDEPFAVILADDLLDHEPPVMQQMTELYDHYRCSIVGVETIAPEATRSYGVVAGREW
DDRLVKLDGIVEKPAPSEAPSNLGVVGRYILTPRIFDHLRNLRPGAGGELQLTDAIQSLL
AEEQILAYRYRGQRFDCGSKFGYLQATVEFALRHPEVRADFETYLNERLGRAPDQATPLG
KSDRRLREDTIALSVAA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaagatcaccaaggccgtgtttcccgtggcggggctcggtacgcgtttccta
cccgccaccaaggccagccccaaagagatgttgccgatcgtcgacaagccgctcatccaa
tatgcggtggaagaggcggccgcggcgggcatcacggagatgatcttcatcaccgggcgc
gccaagcgcgcaatcgaagaccactttgacaaggcgtacgaactcgaaaccgaactggcg
gccaagaacaagcaggcgttgctggacatggtgcagtcaatcaagccggccggcgtcgag
tgtttctatgtgcgccagcccgagacgctggggcttggccacgcggtgttgtgcgcgcag
aaattggtacgcgacgagccctttgccgtgattctggcggacgatctgctcgatcacgag
ccccccgtcatgcagcagatgaccgagctgtacgaccactaccgctgctccattgtcggt
gtcgagacgatcgcgccggaggcgacgcgttcatacggcgtcgtggcggggcgggaatgg
gatgaccggctggtcaagctcgatggcatcgtggagaagccggcgccaagcgaggcgccg
tccaatctgggcgtggttgggcgctatatcctgacgccgcgtatcttcgatcatctgcgc
aacctgaggccgggtgccggcggcgaactgcaattgaccgatgcgatccagagccttctg
gccgaagaacagatcctggcgtatcgctaccgcggtcagcgattcgactgcggcagcaag
tttggctacctgcaggcgacggtcgagtttgcgcttcgccatccggaagtgcgcgctgac
ttcgaaacgtatctgaacgaacgccttggtcgggcgcccgaccaggcgacacccttgggc
aagtcggaccggcggttgcgcgaagacaccattgcgctgagtgtggcggcctga

DBGET integrated database retrieval system