KEGG   Ralstonia pickettii 12D: Rpic12D_3978Help
Entry
Rpic12D_3978      CDS       T00925                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rpf  Ralstonia pickettii 12D
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:560907..562253
Genome map
AA seq 448 aa AA seqDB search
MIENNPSETARHALKLLASRRLAPTPDNFASIYYEIAGNKPDADPPDAERMALVRELREQ
LARTVECCLPVLGEDDASIGPAAWALIRACRSEFEGLGSLNGKLSTFNHWLSLAAEDQSE
IRRALLSLLQLVFENIAELSLDDRWLRGQIEALMKASEAPVSLRRLDDLRRRLMEVIQKQ
SSLKSKSIEAQEEMKRLLAAFMERLSVAAETSGEHHRQMEACAKKIESANSIAEIAPAIQ
DALSATRWMSLESARNRDVLSAMKVKAEEAAAEVAQLRKALDMASASARHDLLTGALNRK
GLEEALEREVARAARQNTALCIAFLDIDDFKAINDTHGHSFGDDALSHLAQVARESMRPQ
DTLARFGGEEFVILMPDTSLEEGVQTIVRLQRALTQRFFAAGDTRLFITFSAGVAEVGKN
EPPMAAIQRADRGMYQAKRAGKNKVVSV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaacaatccctcggagaccgcccggcacgccctcaagctgctggcctcacgc
aggttggcgcccacgccagacaacttcgcctcgatctattacgaaatcgccggcaacaag
cccgacgcagaccccccggatgccgagcggatggcgctcgtgcgtgagttgcgcgagcag
cttgcgcgcacggtcgaatgctgtctgccagtgctcggtgaagacgatgccagcatcggc
cccgcggcctgggcgctgatccgggcctgccggtccgaattcgaaggccttggcagtttg
aacggcaagctctcgacgttcaaccactggctgtcgctggcggccgaagaccagagcgag
atccgcagggcattgctgagcctgctgcaactggtgtttgagaacatcgccgagctgtcg
ttggacgaccgttggctgcgcggccagatcgaagccctgatgaaggccagcgaggccccc
gtcagcctgcgccggctggacgatctgcggcgccgcctcatggaggtgatccagaagcaa
agctcgctgaagtcgaagtcgatcgaagcccaggaagaaatgaagcggctgctggccgcc
ttcatggagcgcctgtccgttgccgcagaaacctcgggcgagcatcaccgccagatggaa
gcctgcgccaaaaagattgaatcggccaacagcatcgccgagattgcgccggccattcag
gatgcgctgtcggccacccgctggatgtcgctggagtcggcccgcaaccgcgacgtgctg
tcggcgatgaaggtcaaggccgaagaggccgccgccgaggtggcgcaactgcgcaaggcg
ctcgacatggcatcggcgtcggcgcgtcacgacctgctgacgggcgcgctcaaccgcaag
ggtctggaagaggcgctggagcgcgaagttgcccgcgcggcccgccagaacacggcactc
tgcatcgcgttcctggacatcgacgacttcaaggcgatcaacgatacgcacggccacagc
tttggtgacgatgcgctgtcgcacctggcccaggtggcccgcgaatcgatgcgcccgcaa
gacacgctcgcccgctttggcggcgaagaattcgtgatcctgatgccggacacgtcgctg
gaagagggcgtgcagaccatcgtccgcctgcagcgcgcgctcacgcagcgcttctttgcg
gcgggcgatacgcgactgttcatcaccttctctgccggggtggcggaagtcggtaagaac
gaaccgcccatggcagccatccaacgcgccgaccgcggcatgtatcaggccaagcgcgcc
ggcaagaacaaggtggtcagcgtctga

DBGET integrated database retrieval system