KEGG   Ralstonia pickettii 12D: Rpic12D_3978Help
Entry
Rpic12D_3978      CDS       T00925                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rpf  Ralstonia pickettii 12D
Brite
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Rpic12D_3978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:560907..562253
Genome map
AA seq 448 aa AA seqDB search
MIENNPSETARHALKLLASRRLAPTPDNFASIYYEIAGNKPDADPPDAERMALVRELREQ
LARTVECCLPVLGEDDASIGPAAWALIRACRSEFEGLGSLNGKLSTFNHWLSLAAEDQSE
IRRALLSLLQLVFENIAELSLDDRWLRGQIEALMKASEAPVSLRRLDDLRRRLMEVIQKQ
SSLKSKSIEAQEEMKRLLAAFMERLSVAAETSGEHHRQMEACAKKIESANSIAEIAPAIQ
DALSATRWMSLESARNRDVLSAMKVKAEEAAAEVAQLRKALDMASASARHDLLTGALNRK
GLEEALEREVARAARQNTALCIAFLDIDDFKAINDTHGHSFGDDALSHLAQVARESMRPQ
DTLARFGGEEFVILMPDTSLEEGVQTIVRLQRALTQRFFAAGDTRLFITFSAGVAEVGKN
EPPMAAIQRADRGMYQAKRAGKNKVVSV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaacaatccctcggagaccgcccggcacgccctcaagctgctggcctcacgc
aggttggcgcccacgccagacaacttcgcctcgatctattacgaaatcgccggcaacaag
cccgacgcagaccccccggatgccgagcggatggcgctcgtgcgtgagttgcgcgagcag
cttgcgcgcacggtcgaatgctgtctgccagtgctcggtgaagacgatgccagcatcggc
cccgcggcctgggcgctgatccgggcctgccggtccgaattcgaaggccttggcagtttg
aacggcaagctctcgacgttcaaccactggctgtcgctggcggccgaagaccagagcgag
atccgcagggcattgctgagcctgctgcaactggtgtttgagaacatcgccgagctgtcg
ttggacgaccgttggctgcgcggccagatcgaagccctgatgaaggccagcgaggccccc
gtcagcctgcgccggctggacgatctgcggcgccgcctcatggaggtgatccagaagcaa
agctcgctgaagtcgaagtcgatcgaagcccaggaagaaatgaagcggctgctggccgcc
ttcatggagcgcctgtccgttgccgcagaaacctcgggcgagcatcaccgccagatggaa
gcctgcgccaaaaagattgaatcggccaacagcatcgccgagattgcgccggccattcag
gatgcgctgtcggccacccgctggatgtcgctggagtcggcccgcaaccgcgacgtgctg
tcggcgatgaaggtcaaggccgaagaggccgccgccgaggtggcgcaactgcgcaaggcg
ctcgacatggcatcggcgtcggcgcgtcacgacctgctgacgggcgcgctcaaccgcaag
ggtctggaagaggcgctggagcgcgaagttgcccgcgcggcccgccagaacacggcactc
tgcatcgcgttcctggacatcgacgacttcaaggcgatcaacgatacgcacggccacagc
tttggtgacgatgcgctgtcgcacctggcccaggtggcccgcgaatcgatgcgcccgcaa
gacacgctcgcccgctttggcggcgaagaattcgtgatcctgatgccggacacgtcgctg
gaagagggcgtgcagaccatcgtccgcctgcagcgcgcgctcacgcagcgcttctttgcg
gcgggcgatacgcgactgttcatcaccttctctgccggggtggcggaagtcggtaagaac
gaaccgcccatggcagccatccaacgcgccgaccgcggcatgtatcaggccaagcgcgcc
ggcaagaacaaggtggtcagcgtctga

DBGET integrated database retrieval system