KEGG   Ralstonia pickettii 12D: Rpic12D_4047Help
Entry
Rpic12D_4047      CDS       T00925                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rpic12D_4047
Enzymes [BR:rpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rpic12D_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(624640..626922)
Genome map
AA seq 760 aa AA seqDB search
MDRTTNLSGTPRTPLQQLATDAGLLVDWEDAASRPMRVADEVLRAVLFTLGLPAGTPAQV
SESQARLRAEAEAVAIPPLVTGVVGQPIVLQTSAPQAALLDGQPYRVDFESDGSTEGRIS
VSASEHHATLRLAAVQAVGYHRLTIDAGPGTVIEATLAIAPARCYGVADALRQHDRPTDS
RLWGASAQLYGLRCDAERAASSAGLGDYTAAGTLARHLSQRGADALALSPVHAMFTADPR
RYSPYSPSSRLFLNAWMIDPAALFGNETVRQAVVDCNLVADYARLEAAPLIDWPASGNAR
MTVLRALHRRLLQAPLGDTIGQTLLDDFRAYCINGGASLRDHAHFEALNAHLGPAHWKQW
PAQYQDPSYLGVQAFAREHEDAVNFHLFLQWAAARQWAIAQRTAEGAGMAIGLVADLAVG
TDSAGSHAWARQRDLLIGVTVGAPPDVFNAQGQGWGLTTFSPRAMRTQGFSAFIEMLRAV
MAVPGGVRIDHVLGLMRLWVIPDGARPLDGVYLRYPMQDLLRLVALESWRNRCIVIGEDL
GTVPAGLRDKLADDGLLGMRILWFEREYTRDDAPFKAPRTWAPASVAMTSTHDLPTLVGW
WIGNDLRWQAQLGLLPAGMSESEAHARRMDDRAALVAAFAEHNRLVLADGGVPMIGVASL
QAALEQTRVATAAQAEVILQASAQDFATAATVFTGAANTPLALVPLEDLLGLVEQPNLPS
TIDTHPNWRRRLPGPAGTLIEAPTVLARLSALANARNSMS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcacgaccaacctatccggcacgccgcgcacgccgctccagcaactggccacc
gatgccgggctgctggtcgactgggaagatgctgccagccggcccatgcgcgtggccgac
gaggtgctgcgcgccgtgctcttcacgctcggcctgccggccggcaccccggcccaggtg
tcggaaagccaggcgcgcctgcgcgcggaagccgaagcggtggccataccgccgctcgtg
accggcgtggtcgggcaaccgatcgtgctgcagacgtctgcgccccaagccgcgttgctg
gacggacaaccctatcgtgttgatttcgagtccgacggcagcaccgagggcaggatcagc
gtcagcgcaagcgagcaccatgcaacgctgcgcctggcagcggtacaggccgttggctac
caccgcctgaccatcgacgccgggccgggcaccgtgatcgaagccacgctcgccattgct
cctgcgcgttgctatggtgtggccgatgcgctacgccagcacgatcgccccaccgactca
cgcctgtggggcgcctccgcacagctctatggcttgcgatgcgatgcggaacgcgcggcc
agcagcgcaggcctgggcgactacaccgccgcgggcacgctggcgcggcatctctcgcag
cgcggcgcggatgcgttggcactgagccctgtgcacgccatgttcacggccgacccgcgt
cggtattcgccgtactcgccatcgagccgcctgttcctgaacgcgtggatgatcgacccg
gccgcgctctttgggaacgaaaccgtacggcaagccgtggtcgactgcaacctcgtcgcg
gactatgcccggctggaagccgcaccgctcatcgactggccggccagcggcaacgcccgc
atgacggtgctgcgcgcgctgcatcggcgcctgctgcaagcaccgctcggagacaccatc
ggccagacgctgctggacgattttcgcgcgtactgcatcaatggcggcgccagcctgcgc
gaccatgcgcactttgaagcgctgaatgcgcaccttgggcccgcgcattggaagcagtgg
cccgcgcagtatcaagatccgagctacctgggcgttcaggccttcgcgcgtgagcatgaa
gatgcggtgaacttccacctcttcctgcaatgggcggcggcacgccagtgggccatcgcg
cagcgcaccgcggagggcgccggcatggccatcggcctcgtcgccgacctggctgttggc
accgacagcgcaggcagccacgcgtgggcccggcaacgcgacttgctgatcggcgtgacg
gtgggtgcgccgcccgatgtgttcaacgcacagggccagggctggggcctgaccaccttc
agcccgcgtgccatgcgcacgcaaggcttttcggcctttatcgagatgctgcgcgcggtg
atggccgtgcccggcggtgtgcgcatcgaccacgtgctcgggctcatgcggctgtgggtg
attcccgatggcgcgcggccgctcgacggcgtgtacctgcgctacccgatgcaggatctg
ctgcggctggtggcgctggaatcgtggcgcaaccgatgcatcgtcattggcgaagacctg
ggcaccgtgcctgctggcctgcgcgacaagctcgccgacgacggcctgctcggcatgcgc
atcctctggttcgagcgcgaatacacgcgcgacgatgcgcccttcaaggcgccgcgcacg
tgggcgccagcctccgtcgcgatgaccagcacgcacgacctgcccacgctcgtcggctgg
tggatcggcaacgatctgcgctggcaagcccagctcggcctgctgccggccggcatgagc
gagagcgaggcgcacgcgcgccgcatggacgatcgcgccgcactggttgccgcctttgca
gagcacaaccggctggtgctggccgatggcggcgtgccgatgatcggcgtggcgtcgctg
caggcggcgctggaacagacgcgcgtggccaccgcggcgcaagctgaagtcatcttgcaa
gccagcgcgcaggactttgccacggcagccaccgtgtttacgggcgcggccaatacgccg
cttgcgctggtgccgctggaggacttgctcggccttgtcgagcagcccaacctgccgagc
acgatcgacacacacccgaactggcgacgtcgtctgccagggccggccggcacgctgatc
gaggcacccacggtgctggcgcgcctgtcagcgctggccaacgcgcgcaacagcatgtca
tga

DBGET integrated database retrieval system