KEGG   Ralstonia pickettii 12D: Rpic12D_4050Help
Entry
Rpic12D_4050      CDS       T00925                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rpic12D_4050
Enzymes [BR:rpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rpic12D_4050
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpic12D_4050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(631691..633997)
Genome map
AA seq 768 aa AA seqDB search
MTALDFATPTKTAAEPEAPVVLPPGLDQMQVDALTHGRLGDPFAVLGPHRLDTEDGPRWV
VRAFYPGARRVQAIDSRGQIITEMTPVGRTGLFHGPLRADAQDVYGHPELYRLRVIWPAG
TGHEAVQETEDPYAFGLLLGDLDMHLLNEGTHWALASCLGAQAMRIDGISGVRFAVWAPN
AQRVSVVGEFNQWDGRRHPMRLRHQAGVWELFLPSGLGVGPGARYKFELIGADGRLMVKA
DPAARQTEPPPATASVVADPAPLRWNDDAWMQTRAERQKPDAPISIYEVHAGSWLRDLED
GGRNLQWDELADRLIPYVTALGFTHIELLPVAEHPFGGSWGYQPLGLFAPSARFGAPEAF
ARFVDRCHQAGLGVIVDWVPAHFPTDAHGLAQFDGTALYEHQDPREGFHQDWNTLIYNFG
RNEVRGFLIASGLEWLERFHIDGLRVDAVASMLYRDYSRRAGEWVPNRYGGRENLEAVAF
IQKMNTVVHERCPGAITIAEESTAWPGVTAPVEFNGLGFDYKWNMGWMHDTLHYMQRDPV
YRQHHHDGMTFGLVYAFSEHFILPISHDEVVHGKGSLLGKMPGDEWQRLANLRAYLAFMW
THPGKKLLFMGCEFGQVGEWNHDASPEWHLLDDPRHRGVQRLVHDLNALYRNEPSLHARD
TAPEGFNWVIGDDRTNSVFAFLRLDGEGRPMLVVANMTPVPREGYRIGVPPADGATQWRE
VLNTDAAVYGGSDFGNGGAVDVDHVAAHGQEQSLVLRLPPLGVVVLKV
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgctcgactttgccaccccaaccaaaaccgctgccgaacccgaagcaccggtc
gtgctgccgcccggcctcgaccagatgcaggtcgatgcgctgacgcatggccgcctgggt
gacccgtttgcagtgctggggccgcatcgcctcgacactgaagatggcccgcgctgggtc
gtgcgcgctttctacccgggcgcgcgccgtgtgcaggccatcgactcgcgcggccagatc
atcacggagatgacgccggtgggccggacgggactgttccacggacccctgcgcgccgat
gcacaggatgtgtatggccacccggagctgtatcgcctgcgcgtcatctggcctgcgggc
accggccatgaagccgtgcaggaaaccgaagacccatacgccttcgggctgctgctcggc
gatctggacatgcatctgctcaacgagggcacgcattgggcgctggcaagctgcctgggc
gcgcaggcgatgcgcatcgacggcatcagcggcgtgcgctttgcggtgtgggcgccgaac
gcgcagcgcgtgtcggtggtgggcgagttcaaccagtgggacggccgtcgccaccccatg
cgcctgcgccatcaggccggcgtgtgggaactgtttttgccgagcggcttgggcgttggc
cccggcgcgcgctacaagttcgaactgatcggcgccgacggccggctgatggtcaaggcc
gaccccgccgcccgccagaccgaaccgccgcccgccaccgcctccgtcgtggccgacccg
gcgccgctgcgctggaacgacgacgcgtggatgcaaacgcgcgccgaacgccagaagccc
gacgcgcccatcagcatctatgaagtgcatgccggctcctggctgcgcgatctggaagac
ggcggccgcaacctgcaatgggatgagctggccgaccggctgatcccctacgtcacggcg
ctcggcttcacgcacattgaactgctgccggtggcggaacacccgtttggcggcagttgg
ggctatcagccgctggggctgttcgcaccgtctgcgcgctttggggcgcccgaggcgttt
gcgcgctttgtcgaccgctgccatcaggctggcctgggcgtcatcgtcgactgggtgccc
gcgcacttcccgaccgacgcgcacgggctggcgcagtttgacggcaccgcgctgtatgaa
caccaggacccgcgcgaaggcttccatcaggactggaacacgctcatctacaacttcggc
cgcaacgaagtgcgcggattcctcatcgcgagcgggctggaatggctggagcggttccac
attgacggcctgcgcgtggatgccgtggcgtcgatgctgtatcgcgactactcgcgccgc
gccggcgaatgggtccccaaccgctacggcggccgcgaaaacctcgaggccgtggcgttc
atccagaagatgaacacggtcgtgcacgaacgctgccccggcgccatcaccatcgccgaa
gagtcgaccgcctggccgggcgtgaccgcgcccgtggaattcaacggcctgggcttcgac
tacaagtggaacatgggttggatgcacgacacgctgcattacatgcagcgcgaccccgtg
taccggcagcaccatcacgacggcatgacgttcgggctggtgtacgcgttctccgaacac
ttcatcctgccgatctcgcacgacgaggtggttcacggcaagggctcgctgctgggcaag
atgcccggcgatgagtggcaacggctggcgaacctgcgtgcctacctcgcattcatgtgg
acgcatccgggcaagaagctgctgttcatgggctgcgagtttgggcaagtgggcgaatgg
aatcacgacgcatcacccgagtggcatctgctggatgacccgcggcaccgtggcgtgcag
cggctggtgcatgacctcaatgcgctgtaccggaacgaaccgtcattgcatgcgcgagac
accgcgcccgaagggttcaactgggtgattggcgacgaccgcaccaacagcgtgtttgcg
ttcctgcggctcgacggcgaagggcggccgatgctcgtggtggcgaatatgacgccggtg
ccgcgggaggggtatcgcattggcgtgccgccggcggacggggccacgcagtggcgggag
gtgctgaacacggatgctgccgtgtatggcggcagcgatttcgggaacggtggggcggtg
gatgtggaccacgtggcggcgcatgggcaggagcagtcgttggtgttaaggctgccgccg
ttgggggttgtggttttgaaggtttga

DBGET integrated database retrieval system