KEGG   Ralstonia pickettii 12D: Rpic12D_4087Help
Entry
Rpic12D_4087      CDS       T00925                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rpf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rpf00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpf00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rpf00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rpf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:680986..682680
Genome map
AA seq 564 aa AA seqDB search
MNEAVSAAQGFVEARDFLLRHRTDYDRAYREFAWPKLDTFNWALDYFDVMARGNDNPALW
IVDDAQGEGLKLSFAQMSERSSCMANFLRGLGMVRGDRLLLMLPNRVELWDVMLAAMKLG
AVVLPATTQLSPDDVRDRVELGGATCVVVDAAELHKFESVDASVKRIAVGAQRDGWIDLA
AAYDAPAEFVPDGPTKATDPLLLYFTSGTTSKPKLVEHTHQSYPVGHLSTMYWIGLQPGD
IHWNISSPGWAKHAWSCFFAPWNAQACVFVYNYARFVPKDTLDVLVRFNVTTLCAPPTVW
RMLVQEPLATYAVKLREIVGAGEPLNPEIIERVRSAWGVTIRDGFGQTETTCQIGNTPGQ
PVVPGSVGRPLPGYRVELVDHDDQPASEGEIVLPLSHRPLGLMQGYANNAKATAEAMRNG
YYHTSDVAMRRDDGYFVYVGRTDDVFKSSDYRLSPFELESVLIEHEAIAEAAVVPSSDPL
RLSVPKAFVTVRQGYEAGPELARAVFLFSREKLAPYKRIRRLQFSELPKTISGKIRRVEL
RRLELERTPQPARLPGEYWEEDFA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagcggtatctgcagcacagggttttgtggaagcgcgcgattttctgctgcgc
catcgcaccgactacgaccgcgcgtatcgcgagttcgcgtggccgaagctggacacgttc
aactgggcgctcgactacttcgatgtgatggcgcgcggcaacgataacccggcgctgtgg
atcgtcgatgacgcgcagggcgaagggttgaagctgtcgtttgcgcagatgtcggagcgc
tcgtcgtgcatggcgaacttcctgcgcgggcttggcatggtgcgtggtgaccgtctgctg
ctgatgctgccgaaccgcgtcgaactgtgggacgtgatgctcgcggcgatgaagctcggt
gcggtggtgctgccggctacgacgcagctttcgccggatgacgtgcgcgaccgcgttgaa
ctgggcggcgcgacatgcgtggttgttgatgcggcagagttgcacaaattcgagagtgtt
gatgcgagtgtcaagcgcatcgccgtgggcgcgcagcgcgatggctggatcgacctggca
gcggcttacgacgcgcccgcggagttcgtgcccgacggcccgaccaaggcgaccgacccg
ctgctgctgtacttcacctcgggcaccacgtccaagccgaagctcgtcgaacacacgcac
cagagctatccggtcggacacctgtcgaccatgtactggatcggcctgcaacccggcgac
atccactggaacatcagctcacccggctgggcgaaacacgcgtggagttgcttctttgcc
ccgtggaacgcgcaggcctgcgtcttcgtttacaactacgcgcgcttcgtgccgaaggac
acgctggacgtgctggtgcgctttaacgtgaccacgctgtgcgcgccgcccaccgtgtgg
cgcatgctggtgcaggagccgctggccacctacgccgtcaagctgcgcgagatcgtcggt
gcgggcgagccgctgaaccccgagatcatcgagcgcgtgcgcagcgcctggggcgtgacc
attcgcgacggctttggccagaccgagaccacctgccagatcggcaacacgccgggccag
ccggtcgtgccgggctcggtcgggcgcccgctgcccggctaccgcgtggagctggtcgac
cacgacgatcagcccgccagcgaaggcgagatcgtgctgccgctctcgcaccgcccgctc
gggttgatgcagggctatgccaacaacgccaaagccacggccgaggcgatgcgcaacggc
tattaccacacctccgacgtcgcgatgcggcgcgacgacggctacttcgtctatgtgggc
cgcaccgacgacgtgtttaagtcgtccgactaccgcctgagccccttcgagctggaaagc
gtgctgatcgagcacgaagccattgccgaggccgccgtggtgccgagttccgatccgctg
cgcctgtcggtgcccaaggcattcgtgacggtgcgccagggctatgaggctggccctgaa
ctggcccgggccgtgttcctgttctcgcgcgaaaagctggcgccctacaaacgcatccgc
cggctgcagttcagcgagctgcccaagaccatctccggaaagatccggcgcgtggaactg
cgtcggctggagcttgaacgcacgccgcaaccggctcgcctgcctggcgagtactgggaa
gaagactttgcctga

DBGET integrated database retrieval system