KEGG   Ralstonia pickettii 12D: Rpic12D_4171Help
Entry
Rpic12D_4171      CDS       T00925                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rpf00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:771278..773227
Genome map
AA seq 649 aa AA seqDB search
MMTKHQQSPSTQQEEALSVPGRRRFMNSAALAGLATVVACTDKGTPAAAPAASASAPTAT
AAGEHVIAGLHPKPGELDTYYGLWSGGHTGDMRVMGMPSGREIHRIPMFVPDALVGWGIT
NESKKVMGTKPDGSLRYTVGDTHHVHASYKDGNYDGRYAWINDKINSRLGRVRLDYFICD
KITELPNVQGFHGIFPDKRDPLDPKINYTTRVFCGGEFAIPLPNTAGIDDPSKYRSLFTC
VDAETMEVRWQVLIDGNCDLVATSYDGKLAATNQYNTEMGVHYEDMMSAERDACLFFNVA
RIEAAVKAGKFKTIGDSKVPVVDGTHAANQDPKTALTAYVSVPKNPHGVNASPDQKYFVC
AGKLSPTGTVIELSRVLDWFDGKLAKIDDAIVAEVELGLGPLHTAFDGRGNAYTTLFLDS
QIVKWNIDAAIKFHNGDKNAKYVVDRLDVHYQPGHLSASQSETMAADGKFLAVGCKFSKD
RFLPVGPLHPENEQFIDISGDKMVLLQDHPIRSEPHDFIIFKRELLHPKQVYSLDDFPLA
TKDPKQSGVVRNGKKVTVRLTSQAPAYSLREFKLKKGDEVTLILTNLDKVEDLTHGFAIP
KYNINFIVNPQETASVTFIADKPGVFWCYCTHFCHALHLEMRSRMIVEA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaagcaccaacaatcgccatccacacagcaggaagaagcgctgagcgtaccg
gggcggcgtcgcttcatgaatagcgcagcgcttgccgggttggcaacggtcgtggcatgc
actgacaagggcacacccgctgccgcacccgccgcatctgccagcgcgcccacggccacg
gccgcaggggaacacgtcatcgcgggcttgcatccgaagccgggtgaactcgacacctac
tacggcctgtggagcggcggacataccggtgacatgcgtgtcatgggcatgccctcgggg
cgcgagatccatcgcattccgatgttcgtgcccgatgcgctggtcggctggggcatcacg
aacgaatcgaagaaggtgatgggtacgaagcccgacggcagtctcaggtacacggtgggc
gatacccaccacgtgcacgcgtcgtacaaggatgggaattacgacggccgctatgcgtgg
atcaacgacaagatcaactcgcgcctggggcgcgtgcggctcgactacttcatctgcgac
aagatcaccgaactgccgaacgtgcagggcttccacggcatcttcccggacaagcgcgat
ccgctcgacccgaagatcaactacacgacgcgcgtgttctgcggcggcgagtttgcgatc
ccgctaccgaacacggcgggcatcgatgatccgtccaagtaccgttcactgttcacgtgc
gtggacgctgaaaccatggaagtgcgctggcaggtgctgatcgacggcaattgcgacctc
gtcgcaacgtcgtacgacggcaagctggccgcgaccaaccagtacaacaccgagatgggc
gtgcactacgaagacatgatgtctgcggagcgcgatgcctgtctgttcttcaacgttgcg
cgcatcgaggcggcggtcaaggccggcaagttcaagaccatcggcgactccaaggtgccg
gtggtggacggcacgcacgcggccaaccaggatccgaagacagcactgaccgcttatgtg
tcggtgccgaagaatccgcacggcgtcaatgccagccccgaccagaagtacttcgtctgt
gccggcaagctttcgcccaccggtacggtcatcgagctgtctcgcgtgctcgactggttc
gacggcaagctcgccaagatcgacgacgccatcgtggcggaggtcgaacttggcctgggg
ccgctgcacactgcgttcgacgggcgcggcaacgcatacacgacgctgttcctcgacagc
cagatcgtgaagtggaacattgacgccgccatcaagttccacaacggtgacaagaacgcg
aagtacgtggtcgaccgccttgacgtgcattaccagccgggccacctgagcgcatcgcaa
tccgaaaccatggccgccgacggcaagttcctcgccgtgggctgcaagttctccaaggac
cgcttcctgcccgttggcccgctgcaccccgaaaacgaacagttcatcgacatctccggc
gacaagatggtgctgctgcaggaccacccgatccgcagcgagccgcacgacttcatcatc
ttcaagcgcgagctgctgcacccgaagcaggtctattcgctggacgatttcccgctggcc
accaaggacccgaagcagtccggcgtggtgcgcaatggcaagaaggtgacggtgcggctc
acctcgcaggcaccggcgtacagcctgcgcgagttcaagctgaagaagggcgacgaggtc
acgctgatcctcaccaatctggacaaggtcgaggatctgacgcacggcttcgcgattccg
aaatacaacatcaacttcatcgtcaatccgcaggaaaccgcgtcggtcacgttcattgcc
gataagcccggcgtgttctggtgctactgcacgcatttctgtcatgcactgcaccttgaa
atgcgcagtcgcatgatcgttgaggcctga

DBGET integrated database retrieval system