KEGG   Ralstonia pickettii 12D: Rpic12D_4255Help
Entry
Rpic12D_4255      CDS       T00925                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00010  Glycolysis / Gluconeogenesis
rpf00620  Pyruvate metabolism
rpf00640  Propanoate metabolism
rpf00680  Methane metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_4255
   00620 Pyruvate metabolism
    Rpic12D_4255
   00640 Propanoate metabolism
    Rpic12D_4255
  Energy metabolism
   00680 Methane metabolism
    Rpic12D_4255
Enzymes [BR:rpf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rpic12D_4255
Lipid biosynthesis proteins [BR:rpf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rpic12D_4255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACS65500
JGI: Rpic12D_4255
UniProt: C6BN42
Position
2:856878..858575
Genome map
AA seq 565 aa AA seqDB search
MTSLDAFLRCRDFLLAHREDYDTAVRDFAWPQLDRFNWALDYFDAMARGNDAVALWVVDD
QGNETRLSFAQMAERSARVANHLRALGVQRGDRILLMLGNVPGLWDVMLASIKIGAVIIP
ATTLLTAEDLRERIAMGEVSHVVVGGADCAKLDAVSGTFTRIAVGTDKAPAGWHRFEDAY
DASAEFTPDAPTQASDPLLLYFTSGTTSKPKLVMHTHASYPVGHLSTLYWIGLRPGDVHW
NISSPGWAKHAWSCFFAPWNAGATVFIYNYARFEPKAVLDVLCRAKVTTLCAPPTVWRML
IQEDLAAWKPALRELVGAGEPLNPEVIERVRAAWGITIRDGYGQTETTCQIGNSPGQRVQ
PGSMGRPLPGYRITLRDPDGHEAEEGEICIELNSRPTGLMEGYAGNADKTAEAMRGGVYH
TSDIAARDASGYLTYVGRADDVFKASDYRVSPFELESVLIEHPAIAEAAVVPSPDPLRLA
VPKAFLVLRAGHEAGPELARDILGFCRSRLASYKRVRRIEFADLPKTISGKIRRVELRMR
EAARSENTAGVRNLQEYWEEDFPGD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgctggacgccttcctgcggtgccgcgactttctgctcgcgcaccgtgaggat
tacgataccgctgtgcgcgattttgcatggccccagttggaccgcttcaactgggcgctg
gattatttcgacgccatggcgcgcggcaacgatgccgtcgccctctgggtggtcgacgat
cagggcaacgagacgcggctgtcgtttgcgcagatggccgagcgttcggcgcgcgtggcc
aaccacttgcgggcgcttggcgtgcagcgcggtgaccgcatcctgctcatgctcggcaac
gtgcccgggctatgggacgtgatgctcgccagcatcaagatcggcgcggtcatcatcccg
gccacgacgctgctcaccgcagaagacctgcgcgaacgcattgccatgggggaggtgagc
cacgtggtggtgggcggggcagattgcgccaagctcgacgccgtatcgggcacgttcaca
cgcattgcggtcggtacggacaaggcgccggccggctggcaccgctttgaagacgcctac
gatgcctccgccgaattcacccccgacgcgcccacgcaggcgagcgatccgttgctgctg
tatttcacgtccggcaccacgtccaaacccaaactcgtgatgcatacgcatgcgagctat
ccggtcgggcatttgtccaccctgtactggatcggcctgcgcccgggggatgtgcactgg
aacatcagctcgcccggctgggccaagcacgcgtggagctgcttcttcgcgccgtggaat
gccggcgccaccgtcttcatctacaactacgcgcgcttcgagcccaaagcagtgctggat
gtgctctgccgggccaaggtgacgacgctgtgcgcaccgcccacggtgtggcgcatgttg
atccaggaagacttggccgcgtggaagcccgccctgcgcgaactcgtgggcgcgggcgaa
ccgctcaacccggaggtgatcgaacgggtgcgcgcggcgtggggcatcaccatccgcgac
ggctacggtcagaccgaaacgacctgccagatcggcaacagcccggggcagcgcgtccag
ccaggctcgatgggtcggccgctgccgggatatcgcatcacgctgcgcgaccccgacggc
cacgaagcggaagagggcgagatctgcatcgaattgaattcacgcccgaccggcctgatg
gaaggctacgccggtaacgccgacaaaaccgccgaagccatgcgcggcggcgtgtatcac
acctctgacattgccgcgcgcgatgccagcggctacctgacctacgtgggccgcgccgat
gacgtattcaaggcatcggattaccgtgtcagcccattcgagctggagagcgtgctgatc
gaacaccctgccatcgcggaggccgccgtcgtgccgagccccgacccgctgcgccttgcc
gtgccgaaggctttcttggtactgcgtgcggggcacgaggccggcccggaactggcgcgg
gacatcctcggattttgccgcagccgattggcttcctacaaacgcgtgcgccgcatcgaa
tttgccgatctgcccaaaaccatctcgggcaagatccggcgagtcgaactgcgcatgcgt
gaagccgcgcgcagcgagaacaccgctggcgtgcgcaacctgcaggaatattgggaagag
gatttcccgggcgattga

DBGET integrated database retrieval system