KEGG   Ralstonia pickettii 12D: Rpic12D_4368Help
Entry
Rpic12D_4368      CDS       T00925                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rpf00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rpf00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rpf00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:992462..995701
Genome map
AA seq 1079 aa AA seqDB search
MRSASELPANASPAAAEPIPQPKGLPWLGNLLQLPKDRLAQTLLETSRQFPQGLYQLDFA
GRRVPFVYSADLVAELCDETRFRKLIGPPLSFLRAGAGDGLFTAHQDEPNWGKAHRILLP
AFSQRAMKGYFDVMLDVANALADKWARQGPDADIPVADDMTRLTLDTISLAGFGYRFDSF
NTPELHPFLAAMVGVLSEAMGKLTRLPLKDRFMREHHRRFEHDVAAMHQLVDEVIRARRQ
AKDGGIGASDLLGLMLNARDPLSDQPLDDTNIRFQVITFLIAGHETTSGLLTFALYMLLR
HPAVLAQAYAEVDRVLPGDTVPQYAHLAQLDVIERVLKETLRLWPTAPSFGVAPYEDTRI
GGRYAIRKDQRVVTVLLALHRDPAVWDRPEAFDIDRFLPENEAKLHPHAYKPFGNGERAC
IGRQFALTEAKLALAVILQRFALSDPYDYGFHIKETLTLKPDGFRLRARLRHARERLSVA
TPSRTEAVTQDDAEGALAGGGEPMHVLYGGSLGTCQDIAEQLAATASRAGFDAKVAPLDT
IADALPQRGTLVVVAATYNGRAPDSARTLEARLDAADALTRQATGLRYAVLGCGNSQWPA
FQAFPKRVEAMLAAAGAHAIVPRGEADGNAGFDAAVDAWTRSLWSALGARQTHADGPSVR
VDYVAPDALRAAMLPPAARAMTVLANEELVSDATGLWDFTREAPRGPTRHLTVQLPDDVT
YATGDHLAVYPRNADDRVDAAIARLALEADALVTLTARHAHVRHLPLNQPVSVRQLLRDF
VELQDTATVRDITALHAATRCPFTRGQLAVWLEGDDAAERFDQDIQAPHVSVLDLLIRLP
AIELTLEAFLARLGPMRPRFYSIASSARVSPGVAALTVGTVSGPAWSGVGTYRGTASNYL
MTLRAGAEIAAAVRTPNPPFAPDVDAHKPMVLIGAGTGIAPFRGFLEERAAQQAAGEAVA
TSLLCFGCRHPEHDFLYRDTLRAWEDAGLVRVFPAYSCVAEHPHRFVQHALWDAREAVWA
AFDAGATLYVCGDGRAMAPAVRDTLIRMHQARYGSDLATASGWLTAQMQSGRYRQDVFN
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccgcctccgagttgcccgccaatgcctcgcccgctgcggcggagcccatcccg
cagcccaaaggcttgccgtggctgggcaacctgctgcaactccctaaagaccgcctggcc
cagacgcttctggaaaccagccggcagtttccccaaggcctctaccagctcgactttgcc
gggcggcgcgtgccgttcgtctattccgccgatctggtggctgaactctgcgacgaaacg
cgctttcgcaagctgatcggcccgccgctgtcgttcctgcgggcgggagcgggcgatggc
ctcttcacggcgcatcaggacgagcccaactggggcaaggcgcatcgcattctgctgccg
gccttcagccagcgtgcgatgaagggctacttcgacgtgatgctcgacgtggccaatgcg
ctggccgacaaatgggcgcgccaggggccagacgccgatatccccgtggccgacgacatg
acgcggctcacgctcgacaccatctcgctggcgggttttggataccgcttcgattcgttc
aacacgcccgagctgcatccgttcctggcggccatggtgggtgtgctgtccgaagccatg
ggcaagctcacgcgcctgccgctcaaagaccgcttcatgcgcgagcaccatcggcggttc
gagcacgacgtggccgccatgcatcaactggtggacgaggtgatccgcgcgcgccgtcag
gcaaaagatggcggcatcggcgcgagcgacttgctggggctgatgctcaacgcgcgcgat
ccgctatcagaccagccgctggatgacaccaacatccgcttccaggtcatcactttcctg
atcgccgggcatgaaaccacgagcggcctgctgacctttgcgctgtacatgctgctgcgc
catccagccgtgctggcgcaggcgtatgccgaggttgaccgcgtgctgccgggcgatacc
gtgccgcagtatgcgcacctcgcgcagttggatgtgatcgagcgcgtgttgaaggaaacg
ctgcgcctctggccgaccgcccccagctttggcgtggcgccctacgaagacacgcgcatt
ggcggccgctacgccatccgcaaggaccagcgcgtggtgaccgtgctgctggcgctgcat
cgcgatccggcggtgtgggatcgccccgaagccttcgatatcgaccgcttcctgccagag
aacgaagcgaagctccacccgcacgcctacaagcccttcggcaatggcgagcgcgcctgc
atcggccgccagtttgcgctgaccgaagccaaactggcgcttgcggtgatcctgcagcgc
ttcgcgctgtccgacccttacgattacggcttccacatcaaggaaacactgacgctcaaa
ccggacggtttccgcctgcgcgcgcggctgcgccatgcacgggagcggttgtcggtcgcc
acgccttcgcgcaccgaggccgtcacgcaagacgatgccgaaggggcgcttgcggggggc
ggggaaccgatgcacgtgctgtacggcggcagccttggcacctgccaggacatcgccgag
cagcttgccgccaccgcatcgcgcgccgggttcgacgccaaggtggcgccgctcgacacc
attgccgacgcgctgccgcagcggggcacgctcgttgtggtggccgccacctacaacggc
cgtgcaccggacagcgcccgcacacttgaggcgcggctggatgccgccgatgcgctcacc
cggcaggcaaccggattgcgctatgccgtccttggctgcggcaactcgcaatggcctgcg
ttccaggcgtttccaaagcgggtggaagcgatgctcgcggcagccggcgcgcacgccatc
gtgccgcgcggtgaggcggacggaaatgccggtttcgatgctgccgtcgacgcctggacg
cgcagcctttggagcgccctgggcgcccgccagacacatgccgacggcccgtccgtccgc
gtcgactacgttgcgcctgatgcgctccgcgccgccatgctgccgcccgccgcacgggcg
atgacggtgctcgccaatgaagaactcgtcagcgacgccaccggcctgtgggatttcacg
cgggaggcgccgcgcggcccgacgcgtcatctcacggtgcagttgcccgacgacgtgacc
tacgccacgggagaccacctcgctgtctacccacgcaatgccgacgaccgtgtcgacgca
gccatcgcgcggcttgcgctggaggccgatgcgctcgtcaccctgaccgcgcgccatgcg
cacgtgcgccacctgccgctcaaccagccggtgtccgtgcgtcagttgttgcgtgatttc
gtcgagctgcaggacaccgccaccgtgcgcgacatcaccgcgctgcacgcggccacgcgc
tgtccgttcacgcgaggccaacttgccgtctggctggaaggcgacgatgcggccgagcgc
ttcgaccaggacattcaagccccgcacgtgagcgtgctcgatctgctgatccgcttgcct
gcaattgagttgaccctggaagcattcctcgcgcggcttgggccgatgcgcccgcgtttc
tattccatcgcgtcgtcggcgcgtgtgtcgcccggcgtggccgcgctaacggtgggcacg
gtgtcagggccggcttggtccggggtgggtacgtatcgcgggacggcatcgaactacctg
atgacgttgcgtgcaggcgcggagatcgctgccgccgtccgcacgcccaacccgccgttc
gcaccggacgtagacgcccataagccgatggtgctgatcggcgccggtacaggcatcgcg
ccgttccgtggattcctggaagaacgcgccgcgcagcaggcggcaggtgaggcggtggcg
acgtcgttgctctgcttcggctgtcgccaccccgagcacgactttctctaccgcgacacc
ttgcgtgcgtgggaagacgcaggtttggtgcgcgtctttcccgcgtattcctgcgtggcc
gagcatccgcatcgcttcgtgcagcatgccctgtgggatgcgcgcgaagccgtgtgggcg
gcgttcgatgcaggcgcgaccttgtacgtgtgcggcgacggtcgtgcgatggcgccagcg
gtgcgcgacacgctgatccgcatgcaccaggcgcgctacggtagcgacctggcgaccgcg
tccggctggttgacggcgcagatgcaatctggccgctaccgtcaggacgtcttcaactga

DBGET integrated database retrieval system