KEGG   Ralstonia pickettii 12D: Rpic12D_4368Help
Entry
Rpic12D_4368      CDS       T00925                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Rpic12D_4368
  Amino acid metabolism
   00380 Tryptophan metabolism
    Rpic12D_4368
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rpic12D_4368
Enzymes [BR:rpf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Rpic12D_4368
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Rpic12D_4368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:992462..995701
Genome map
AA seq 1079 aa AA seqDB search
MRSASELPANASPAAAEPIPQPKGLPWLGNLLQLPKDRLAQTLLETSRQFPQGLYQLDFA
GRRVPFVYSADLVAELCDETRFRKLIGPPLSFLRAGAGDGLFTAHQDEPNWGKAHRILLP
AFSQRAMKGYFDVMLDVANALADKWARQGPDADIPVADDMTRLTLDTISLAGFGYRFDSF
NTPELHPFLAAMVGVLSEAMGKLTRLPLKDRFMREHHRRFEHDVAAMHQLVDEVIRARRQ
AKDGGIGASDLLGLMLNARDPLSDQPLDDTNIRFQVITFLIAGHETTSGLLTFALYMLLR
HPAVLAQAYAEVDRVLPGDTVPQYAHLAQLDVIERVLKETLRLWPTAPSFGVAPYEDTRI
GGRYAIRKDQRVVTVLLALHRDPAVWDRPEAFDIDRFLPENEAKLHPHAYKPFGNGERAC
IGRQFALTEAKLALAVILQRFALSDPYDYGFHIKETLTLKPDGFRLRARLRHARERLSVA
TPSRTEAVTQDDAEGALAGGGEPMHVLYGGSLGTCQDIAEQLAATASRAGFDAKVAPLDT
IADALPQRGTLVVVAATYNGRAPDSARTLEARLDAADALTRQATGLRYAVLGCGNSQWPA
FQAFPKRVEAMLAAAGAHAIVPRGEADGNAGFDAAVDAWTRSLWSALGARQTHADGPSVR
VDYVAPDALRAAMLPPAARAMTVLANEELVSDATGLWDFTREAPRGPTRHLTVQLPDDVT
YATGDHLAVYPRNADDRVDAAIARLALEADALVTLTARHAHVRHLPLNQPVSVRQLLRDF
VELQDTATVRDITALHAATRCPFTRGQLAVWLEGDDAAERFDQDIQAPHVSVLDLLIRLP
AIELTLEAFLARLGPMRPRFYSIASSARVSPGVAALTVGTVSGPAWSGVGTYRGTASNYL
MTLRAGAEIAAAVRTPNPPFAPDVDAHKPMVLIGAGTGIAPFRGFLEERAAQQAAGEAVA
TSLLCFGCRHPEHDFLYRDTLRAWEDAGLVRVFPAYSCVAEHPHRFVQHALWDAREAVWA
AFDAGATLYVCGDGRAMAPAVRDTLIRMHQARYGSDLATASGWLTAQMQSGRYRQDVFN
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccgcctccgagttgcccgccaatgcctcgcccgctgcggcggagcccatcccg
cagcccaaaggcttgccgtggctgggcaacctgctgcaactccctaaagaccgcctggcc
cagacgcttctggaaaccagccggcagtttccccaaggcctctaccagctcgactttgcc
gggcggcgcgtgccgttcgtctattccgccgatctggtggctgaactctgcgacgaaacg
cgctttcgcaagctgatcggcccgccgctgtcgttcctgcgggcgggagcgggcgatggc
ctcttcacggcgcatcaggacgagcccaactggggcaaggcgcatcgcattctgctgccg
gccttcagccagcgtgcgatgaagggctacttcgacgtgatgctcgacgtggccaatgcg
ctggccgacaaatgggcgcgccaggggccagacgccgatatccccgtggccgacgacatg
acgcggctcacgctcgacaccatctcgctggcgggttttggataccgcttcgattcgttc
aacacgcccgagctgcatccgttcctggcggccatggtgggtgtgctgtccgaagccatg
ggcaagctcacgcgcctgccgctcaaagaccgcttcatgcgcgagcaccatcggcggttc
gagcacgacgtggccgccatgcatcaactggtggacgaggtgatccgcgcgcgccgtcag
gcaaaagatggcggcatcggcgcgagcgacttgctggggctgatgctcaacgcgcgcgat
ccgctatcagaccagccgctggatgacaccaacatccgcttccaggtcatcactttcctg
atcgccgggcatgaaaccacgagcggcctgctgacctttgcgctgtacatgctgctgcgc
catccagccgtgctggcgcaggcgtatgccgaggttgaccgcgtgctgccgggcgatacc
gtgccgcagtatgcgcacctcgcgcagttggatgtgatcgagcgcgtgttgaaggaaacg
ctgcgcctctggccgaccgcccccagctttggcgtggcgccctacgaagacacgcgcatt
ggcggccgctacgccatccgcaaggaccagcgcgtggtgaccgtgctgctggcgctgcat
cgcgatccggcggtgtgggatcgccccgaagccttcgatatcgaccgcttcctgccagag
aacgaagcgaagctccacccgcacgcctacaagcccttcggcaatggcgagcgcgcctgc
atcggccgccagtttgcgctgaccgaagccaaactggcgcttgcggtgatcctgcagcgc
ttcgcgctgtccgacccttacgattacggcttccacatcaaggaaacactgacgctcaaa
ccggacggtttccgcctgcgcgcgcggctgcgccatgcacgggagcggttgtcggtcgcc
acgccttcgcgcaccgaggccgtcacgcaagacgatgccgaaggggcgcttgcggggggc
ggggaaccgatgcacgtgctgtacggcggcagccttggcacctgccaggacatcgccgag
cagcttgccgccaccgcatcgcgcgccgggttcgacgccaaggtggcgccgctcgacacc
attgccgacgcgctgccgcagcggggcacgctcgttgtggtggccgccacctacaacggc
cgtgcaccggacagcgcccgcacacttgaggcgcggctggatgccgccgatgcgctcacc
cggcaggcaaccggattgcgctatgccgtccttggctgcggcaactcgcaatggcctgcg
ttccaggcgtttccaaagcgggtggaagcgatgctcgcggcagccggcgcgcacgccatc
gtgccgcgcggtgaggcggacggaaatgccggtttcgatgctgccgtcgacgcctggacg
cgcagcctttggagcgccctgggcgcccgccagacacatgccgacggcccgtccgtccgc
gtcgactacgttgcgcctgatgcgctccgcgccgccatgctgccgcccgccgcacgggcg
atgacggtgctcgccaatgaagaactcgtcagcgacgccaccggcctgtgggatttcacg
cgggaggcgccgcgcggcccgacgcgtcatctcacggtgcagttgcccgacgacgtgacc
tacgccacgggagaccacctcgctgtctacccacgcaatgccgacgaccgtgtcgacgca
gccatcgcgcggcttgcgctggaggccgatgcgctcgtcaccctgaccgcgcgccatgcg
cacgtgcgccacctgccgctcaaccagccggtgtccgtgcgtcagttgttgcgtgatttc
gtcgagctgcaggacaccgccaccgtgcgcgacatcaccgcgctgcacgcggccacgcgc
tgtccgttcacgcgaggccaacttgccgtctggctggaaggcgacgatgcggccgagcgc
ttcgaccaggacattcaagccccgcacgtgagcgtgctcgatctgctgatccgcttgcct
gcaattgagttgaccctggaagcattcctcgcgcggcttgggccgatgcgcccgcgtttc
tattccatcgcgtcgtcggcgcgtgtgtcgcccggcgtggccgcgctaacggtgggcacg
gtgtcagggccggcttggtccggggtgggtacgtatcgcgggacggcatcgaactacctg
atgacgttgcgtgcaggcgcggagatcgctgccgccgtccgcacgcccaacccgccgttc
gcaccggacgtagacgcccataagccgatggtgctgatcggcgccggtacaggcatcgcg
ccgttccgtggattcctggaagaacgcgccgcgcagcaggcggcaggtgaggcggtggcg
acgtcgttgctctgcttcggctgtcgccaccccgagcacgactttctctaccgcgacacc
ttgcgtgcgtgggaagacgcaggtttggtgcgcgtctttcccgcgtattcctgcgtggcc
gagcatccgcatcgcttcgtgcagcatgccctgtgggatgcgcgcgaagccgtgtgggcg
gcgttcgatgcaggcgcgaccttgtacgtgtgcggcgacggtcgtgcgatggcgccagcg
gtgcgcgacacgctgatccgcatgcaccaggcgcgctacggtagcgacctggcgaccgcg
tccggctggttgacggcgcagatgcaatctggccgctaccgtcaggacgtcttcaactga

DBGET integrated database retrieval system