KEGG   Ralstonia pickettii 12D: Rpic12D_4490Help
Entry
Rpic12D_4490      CDS       T00925                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpf  Ralstonia pickettii 12D
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_4490
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpic12D_4490
   00650 Butanoate metabolism
    Rpic12D_4490
  Energy metabolism
   00190 Oxidative phosphorylation
    Rpic12D_4490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1125332..1125697
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTVVLLAAFLLSKDTSYQSWAGLFSN
QWMKMLTFLAFVSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataacaatattggtcccaagcgcctcgttgtgggcgcgcactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtgatcatggcggtctacaccgtcgtgctgctg
gcggcgttcctgctctcgaaagacacgtcgtaccaaagctgggcggggctgttctccaac
cagtggatgaagatgctgacgttcctggcgttcgtgtcgctcacgtatcacgcctggatc
ggtgtgcgtgacatctggatggactacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgtgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system