KEGG   Ralstonia pickettii 12D: Rpic12D_4510Help
Entry
Rpic12D_4510      CDS       T00925                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rpic12D_4510
Enzymes [BR:rpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rpic12D_4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1147758..1149314)
Genome map
AA seq 518 aa AA seqDB search
MPVMTTVSMPPVDASIAPLGCLRFKALGIDTWQEHVIYMHPDSAICRSEGFAAQARVEVQ
IGQRSLIATLNLVGSGLLEKHEVSLSASAVDSLMARPGDEVCVRHAPSLESLRALRAKIY
GGHLDAKQLQEIIADISHERYADVHIAAFLSACASSRMTIKETIDLTQAMVDSGERLQWD
RAVVADKHCVGGLPGNRTSPIVVAICAAAGLLLPKTSSRAITSPAGTADMMETLTRVNLS
AAELRCVVGQVGASLAWGGALSLSPADDVLIRVERALDVDSDAQLVASILSKKIAAGSTH
VLIDVPVGPTAKVRSVEDLERLEMLLKRVAQAFGVQVLMVRTDGAQPVGRGIGPALEARD
VLAVLQRTPTAPFDLRERSLLLAGALLEFCGTAVAGTGLVMATDLLDSGAAWRKFEAICE
AQGGLRIPGEAVFRRDVVAEQNGIVTHIDNRHLARIAKLAGAPMRQVAGVQMRVRLRDQV
NVGQPLFTIHAQASGELEYSSAYALTHAVVGLSPMGIG
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcatgaccaccgtctccatgcccccagttgacgcgtccattgccccgctggga
tgcctcaggttcaaggcgcttggcattgacacgtggcaggagcacgtcatctacatgcac
cctgacagcgcgatctgccggtccgagggctttgccgcgcaggcccgcgtagaagtccag
atcgggcagcgatcgctgatcgccacgctgaacctcgtgggctcggggttgctggaaaag
catgaggtgagcctgtcagccagcgcggtcgattcgttgatggcgcgcccgggtgacgaa
gtctgcgtcaggcacgcgccgtcgcttgagtcgctgcgcgccctgcgggccaagatctat
ggcgggcatctggacgccaagcaattgcaggagatcattgctgacatctcgcatgagcgt
tatgccgatgtccatatcgcggcattcctgagcgcctgcgcatccagccgcatgaccatc
aaggaaaccatcgacctcacacaagcgatggtcgactccggagagcgtctgcagtgggac
cgcgcggtcgtggcagacaagcactgcgtgggcggtctgcccggcaatcgcaccagccct
atcgtcgttgccatctgtgcggcggcggggctgctgctgcctaaaacgtcgtcacgcgcc
atcacctcgcctgcgggtaccgccgacatgatggaaacgctcacccgcgtcaacctgagc
gcggcagagttgcgatgcgttgtggggcaggttggggcatcgctcgcgtggggcggggca
ttgagtctcagcccggcggacgacgtcttgattcgagtggaaagggcactggacgtcgac
agcgatgcccagcttgtggcgtccattctctccaagaagatcgcggccgggtccacccat
gtgttgatcgacgtgcctgtggggccgacggccaaagtccgcagtgtcgaagaccttgaa
cgccttgaaatgctgctcaagcgtgtggcgcaagcttttggggtgcaggtgctgatggtg
cgcacggatggcgcgcagcccgttggccgcgggatcggccctgcgctggaagcaagagac
gttctggctgtactccaacggacccctaccgcgccgttcgacttgcgggaacggtctcta
ttgctggccggcgcattgctggagttttgcggtacggctgttgccggaacggggcttgtc
atggcaaccgacctgctggacagcggtgctgcatggcgaaaattcgaagcgatctgcgag
gcgcagggtggcttgcgcatccccggagaagccgtgttccgccgcgacgtcgttgccgag
caaaatggaatcgtcacccacatcgacaaccgccaccttgcccgcattgcgaagcttgcg
ggcgcgccgatgcgtcaagtcgcgggcgtacagatgcgtgtgcgactgcgggatcaagtg
aatgttgggcaaccgctgttcacgatccacgcgcaggcctcgggcgagctggagtattcg
tcggcatatgcgttgacgcatgctgtggtgggactgtctccgatgggaatcggttga

DBGET integrated database retrieval system