KEGG   Ralstonia pickettii 12D: Rpic12D_4510Help
Entry
Rpic12D_4510      CDS       T00925                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00240  Pyrimidine metabolism
rpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rpic12D_4510
Enzymes [BR:rpf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rpic12D_4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_trans_3N PYNP_C Glycos_transf_3 AlkA_N
Motif
Other DBs
NCBI-ProteinID: ACS65752
JGI: Rpic12D_4510
UniProt: C6BNU4
Position
2:complement(1147758..1149314)
Genome map
AA seq 518 aa AA seqDB search
MPVMTTVSMPPVDASIAPLGCLRFKALGIDTWQEHVIYMHPDSAICRSEGFAAQARVEVQ
IGQRSLIATLNLVGSGLLEKHEVSLSASAVDSLMARPGDEVCVRHAPSLESLRALRAKIY
GGHLDAKQLQEIIADISHERYADVHIAAFLSACASSRMTIKETIDLTQAMVDSGERLQWD
RAVVADKHCVGGLPGNRTSPIVVAICAAAGLLLPKTSSRAITSPAGTADMMETLTRVNLS
AAELRCVVGQVGASLAWGGALSLSPADDVLIRVERALDVDSDAQLVASILSKKIAAGSTH
VLIDVPVGPTAKVRSVEDLERLEMLLKRVAQAFGVQVLMVRTDGAQPVGRGIGPALEARD
VLAVLQRTPTAPFDLRERSLLLAGALLEFCGTAVAGTGLVMATDLLDSGAAWRKFEAICE
AQGGLRIPGEAVFRRDVVAEQNGIVTHIDNRHLARIAKLAGAPMRQVAGVQMRVRLRDQV
NVGQPLFTIHAQASGELEYSSAYALTHAVVGLSPMGIG
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcatgaccaccgtctccatgcccccagttgacgcgtccattgccccgctggga
tgcctcaggttcaaggcgcttggcattgacacgtggcaggagcacgtcatctacatgcac
cctgacagcgcgatctgccggtccgagggctttgccgcgcaggcccgcgtagaagtccag
atcgggcagcgatcgctgatcgccacgctgaacctcgtgggctcggggttgctggaaaag
catgaggtgagcctgtcagccagcgcggtcgattcgttgatggcgcgcccgggtgacgaa
gtctgcgtcaggcacgcgccgtcgcttgagtcgctgcgcgccctgcgggccaagatctat
ggcgggcatctggacgccaagcaattgcaggagatcattgctgacatctcgcatgagcgt
tatgccgatgtccatatcgcggcattcctgagcgcctgcgcatccagccgcatgaccatc
aaggaaaccatcgacctcacacaagcgatggtcgactccggagagcgtctgcagtgggac
cgcgcggtcgtggcagacaagcactgcgtgggcggtctgcccggcaatcgcaccagccct
atcgtcgttgccatctgtgcggcggcggggctgctgctgcctaaaacgtcgtcacgcgcc
atcacctcgcctgcgggtaccgccgacatgatggaaacgctcacccgcgtcaacctgagc
gcggcagagttgcgatgcgttgtggggcaggttggggcatcgctcgcgtggggcggggca
ttgagtctcagcccggcggacgacgtcttgattcgagtggaaagggcactggacgtcgac
agcgatgcccagcttgtggcgtccattctctccaagaagatcgcggccgggtccacccat
gtgttgatcgacgtgcctgtggggccgacggccaaagtccgcagtgtcgaagaccttgaa
cgccttgaaatgctgctcaagcgtgtggcgcaagcttttggggtgcaggtgctgatggtg
cgcacggatggcgcgcagcccgttggccgcgggatcggccctgcgctggaagcaagagac
gttctggctgtactccaacggacccctaccgcgccgttcgacttgcgggaacggtctcta
ttgctggccggcgcattgctggagttttgcggtacggctgttgccggaacggggcttgtc
atggcaaccgacctgctggacagcggtgctgcatggcgaaaattcgaagcgatctgcgag
gcgcagggtggcttgcgcatccccggagaagccgtgttccgccgcgacgtcgttgccgag
caaaatggaatcgtcacccacatcgacaaccgccaccttgcccgcattgcgaagcttgcg
ggcgcgccgatgcgtcaagtcgcgggcgtacagatgcgtgtgcgactgcgggatcaagtg
aatgttgggcaaccgctgttcacgatccacgcgcaggcctcgggcgagctggagtattcg
tcggcatatgcgttgacgcatgctgtggtgggactgtctccgatgggaatcggttga

DBGET integrated database retrieval system