KEGG   Ralstonia pickettii 12D: Rpic12D_4520Help
Entry
Rpic12D_4520      CDS       T00925                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic12D_4520
   01230 Biosynthesis of amino acids
    Rpic12D_4520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_4520
   00030 Pentose phosphate pathway
    Rpic12D_4520
   00051 Fructose and mannose metabolism
    Rpic12D_4520
   00052 Galactose metabolism
    Rpic12D_4520
  Energy metabolism
   00680 Methane metabolism
    Rpic12D_4520
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rpic12D_4520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1157719..1158651)
Genome map
AA seq 310 aa AA seqDB search
MPEIVTLTVNPAIDIATSVERLTDTHKMRCAPARCDPGGGGINVARVVHRLGGDCLAIYL
AGGPVAERLARLLSAEGLSFAALRIEGETRENFSVTELCSHREFRFVMPGPVVLEAEWQR
CLDHLDALQPAPRYLVLSGSLPLGVADDFYAWVIDRAKARGSRVVLDTAGPALRAALPHT
PYLIKPSLNELRQLTGHALETEADCMQTAREIVRKGHAQVVALTLGAGGAMLVTQEEVVR
SGAVGTSILSTIGAGDSFVGGMVWALNRDAGMREAFRYGMAAAAAALSHAGTELGSAAEI
EQRYAEVSLS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaatcgtcacgctcacggtcaatcccgcaatcgatatcgccacgtcggtggag
cgcttgacggatacgcacaagatgcgctgcgcaccggcccgctgtgaccctggagggggc
ggaatcaacgtcgcccgcgttgtccatcgcctgggcggggattgcctcgccatctacctt
gccggcggtccggtggccgagcgattggcgcgtctcctgtcggcagagggcttatcgttc
gccgccctccggatcgaaggggagacgcgagagaatttttccgtgacggaactgtgcagc
caccgggagtttcggttcgtcatgccggggccggtcgtcttagaggcggaatggcagcgc
tgcctggaccacctcgatgcgctgcaaccagcgccgcgctaccttgtgctgagcggaagc
ctgccacttggggttgccgacgatttctatgcatgggtcattgacagggccaaggcgcgc
ggcagccgcgtcgtactggacaccgccggtccggcattgcgtgctgcgttgccgcatacg
ccatacctgatcaagccgagcctgaacgagcttcggcaactgacggggcacgcgctggag
acggaagcggattgcatgcagactgcgcgggagattgtccgcaaggggcacgcgcaggtg
gtcgcgctcaccctgggtgcgggcggcgccatgctcgtcacgcaggaagaggttgtccgc
tcgggtgctgtcggaacgtcaattctcagcacgattggggcaggtgacagcttcgtgggc
ggaatggtgtgggcgctaaaccgcgatgcaggcatgcgagaggcatttcggtacggcatg
gccgccgccgcagccgcgttgagccatgccggtaccgaacttggcagcgccgccgaaatc
gagcagcgctacgcagaggtctcattgtcttga

DBGET integrated database retrieval system