KEGG   Ralstonia pickettii 12D: Rpic12D_5367Help
Entry
Rpic12D_5367      CDS       T00925                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
rpf  Ralstonia pickettii 12D
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rpic12D_5367
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpic12D_5367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRp12D02:complement(258763..259437)
Genome map
AA seq 224 aa AA seqDB search
MIQRPALHAIGIALASLAFGAPARAEGDPARGAQAARTCMACHSFAPSRHLTGPSLAGVL
GRKAGTADGFARYSDALKQSGLVWDKRNLDAWLENPAALVPGNAMTFPGIADARTRADLV
AYIEAVSTGRVKVPDRGLPNLKESDAASRVTSIRFCGDTYRLTTADRKAHVFWEFNLRFK
TDGSAAGPAAGQPVLIGTGMQGDRAAVVFARPEEISAFIQRRCP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacgacctgctcttcatgcgatcgggatcgctttggcctcacttgcctttggc
gcgccggctcgtgcagagggtgaccccgcgcggggtgcacaagccgcccgcacttgcatg
gcgtgccattcatttgcaccgagtcgccacttgacgggcccgagcttggcgggcgttttg
ggacgtaaagcaggcacagccgacggctttgcacgctactctgacgccctcaagcaatca
ggtctggtctgggacaaacggaacctcgatgcgtggcttgagaatccggcggccctggtg
ccgggtaacgcgatgacctttcccggcattgccgatgcacgcacgcgggccgatctggtc
gcctacattgaggcagtttccacggggcgtgtgaaggtgcccgatcgtggcctgccgaat
ttgaaggagtccgatgcggcgtcgcgggtcacctcaatccgcttctgtggcgatacctat
cgcctcaccaccgccgaccggaaggcccacgtcttttgggagttcaacctgcgcttcaaa
accgatggcagtgctgccggcccggctgccggtcaacctgtgctgatcggcacaggcatg
cagggcgaccgcgccgccgtggtttttgcgcgccccgaggaaatctctgccttcattcag
aggcggtgtccataa

DBGET integrated database retrieval system