KEGG   Rickettsia prowazekii GvV257: MA5_01980Help
Entry
MA5_01980         CDS       T01791                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MA5_01980
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MA5_01980
   00650 Butanoate metabolism
    MA5_01980
  Energy metabolism
   00190 Oxidative phosphorylation
    MA5_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492097..492474
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKAKNSSFSKSGSHHWLLQRVTGVILALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVSFVVA
IFYSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaagctaaaaatagcagtttttctaaaagt
ggttcgcatcattggttattgcaaagagtaactggtgtgatattagctttatgttctttt
tggttaatatattttatgttcaccaacaaaaataatgatataaatattattatgtgggaa
tttaaaaagccttttaatatagtaattttattaattaccgttactatttcattgtatcat
tcagtactcgggatgcgtgtagtaattgaggactatataaattgccacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtatcttttgtagtagcg
atattttatagtggataa

DBGET integrated database retrieval system