KEGG   Rickettsia prowazekii GvV257: MA5_02230Help
Entry
MA5_02230         CDS       T01791                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
rpg00020  Citrate cycle (TCA cycle)
rpg00310  Lysine degradation
rpg01100  Metabolic pathways
rpg01110  Biosynthesis of secondary metabolites
rpg01120  Microbial metabolism in diverse environments
rpg01130  Biosynthesis of antibiotics
rpg01200  Carbon metabolism
Module
rpg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MA5_02230
  Amino acid metabolism
   00310 Lysine degradation
    MA5_02230
Enzymes [BR:rpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MA5_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFE52626
Position
complement(554935..556140)
Genome map
AA seq 401 aa AA seqDB search
MSVKIIIPSLGESVTEATIAKWYKKLGDSVKTDELLLEIETEKVTLEVNAPCNGTIEKIA
KTDGANVTVGEEIGEINEVVDTDTACTNNNSYKKQAIVQHDSEQIVDKPASSSNILAPSV
QKLVTENKLDPNNIKGTGRGGRITKCDVLETINTTPVTIETPALNKTNEERTQRVRMSRL
RKTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIE
ALKLIPSINAEIDGDDLLYKNYYDIGVAVGTDQGLVVPVVRDADKMGFADVEQAIGDLAK
KAREGKLSMSDLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEI
RPMMYIALSYDHRIIDGKEGVSFLVKIKNLIENPEKLLLNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaaaattataataccatcgcttggggaatcagtaacagaagcaactattgct
aaatggtataagaaattaggtgattcagttaaaactgatgaattactattagaaatcgaa
actgaaaaagtgactttagaagttaatgctccttgcaacggtactatagagaaaatagca
aaaactgatggtgcaaatgtaacagttggcgaagaaataggtgaaatcaatgaagttgta
gatacagatactgcttgtactaataataattcttataaaaagcaagcaattgtacaacac
gattcagaacagattgtagataaacctgcttcttctagtaatattcttgctccttcagta
caaaaattagtgaccgaaaacaagcttgatccaaataatattaaaggaactggtagaggt
ggtagaattactaaatgtgatgtgctagaaaccataaacactacacctgttactattgag
actcctgcactaaataaaactaatgaagaaagaacacaacgcgtacgtatgtcacgcttg
cgtaaaactattgcacagcgtttaaaagattcacaaaatactgcagctattttgactact
tttaacgaaatcgatatgtcaaaagtcattgctttgcgtaatcaatataaagaagagttt
gagaaaaagcatactgtaaaacttggatttatgtcattttttgttaaagcaacaattgaa
gctttgaagcttattccatcaataaatgcggaaatagatggagatgatttattatataag
aactattacgatataggtgttgcagtaggaacagatcaaggacttgttgtaccagttgtt
agggatgccgataaaatgggttttgctgatgtagagcaagctatcggagatttggcaaaa
aaagctcgtgaggggaaactttctatgtctgatttgtcaggtggtacattctcaatttct
aatggaggagtatatggctcattattatctacaccgattattaatcctcctcaatcaggt
attctaggattacataaaactgaggaaagagctgtagttatagacggtaaaattgaaata
cgtccaatgatgtatatagccttatcttacgatcatcgtataattgatggaaaagaggga
gtatcattcttggtaaaaattaaaaatcttattgagaatcctgagaagttattattaaac
ttgtag

DBGET integrated database retrieval system