KEGG   Rickettsia prowazekii GvV257: MA5_03215Help
Entry
MA5_03215         CDS       T01791                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MA5_03215 (folE)
Enzymes [BR:rpg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MA5_03215 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812028..812600
Genome map
AA seq 190 aa AA seqDB search
MSKPTREEAKEAVRTLLKFIGEDPNREGLLKTPDRVINSYTEIFSGYGKDAQEILNTKFY
DICNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIPDNCIIGVSKLARIVNIFARRLQI
QEKMTLEIAESVQENLKPLGVAVKISALHSCMSMRGVMHDNSVMNTMYYTGIFAEQQKYR
YEFLNLIAKR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaactagagaagaagcaaaagaagcagtcaggacattactcaaattcatt
ggtgaagatccaaatagagaaggtttgcttaaaacgcctgatagagtaataaatagctat
acggaaatattttccggttatggaaaggatgcacaagaaatattaaatacaaaattttat
gatatttgtaattttcaggatttgatttcacttgaaggaataaaatttacatcattttgt
gaacatcatattttgcctttcaatggtacagtacatatagcttatatccctgataactgt
attatcggtgtaagtaaattagcacgaatagtcaatatttttgctagaaggttacaaatt
caagaaaaaatgactttagagatagcagaaagtgtacaggagaatttaaagcctcttggt
gttgctgttaagatttctgccttacatagttgtatgtcgatgcgtggcgtgatgcacgat
aacagtgttatgaatactatgtattatacaggtatatttgctgagcagcaaaaatatcgt
tatgagttcctaaatcttatcgctaaaaggtag

DBGET integrated database retrieval system