KEGG   Rickettsia prowazekii GvV257: MA5_03905Help
Entry
MA5_03905         CDS       T01791                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
rpg00010  Glycolysis / Gluconeogenesis
rpg00020  Citrate cycle (TCA cycle)
rpg00620  Pyruvate metabolism
rpg01100  Metabolic pathways
rpg01110  Biosynthesis of secondary metabolites
rpg01120  Microbial metabolism in diverse environments
rpg01130  Biosynthesis of antibiotics
rpg01200  Carbon metabolism
Module
rpg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MA5_03905
   00020 Citrate cycle (TCA cycle)
    MA5_03905
   00620 Pyruvate metabolism
    MA5_03905
Enzymes [BR:rpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MA5_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFE52955
Position
complement(996938..998164)
Genome map
AA seq 408 aa AA seqDB search
MPIKILMPALSPTMREGNLARWLKKEGDKVNPGEVIAEIETDKATMEVESVDEGILAKII
IPQNSQNVPVNSLIAVLSEEGEDKADIDSFIAQNNSVSLSLKTDATLKKSNDSITNIEGI
KHDSNKIFASPLAKRLAKIGDIRLENVQGSGPHGRIVKQDILSYDSSTSSNKIVYRDTEE
YRSVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDVREDINKSFSEDKVTKISVN
DFIILAVAKALQEVPNANASWSEDAIRYYNNVDISVAVAIENGIVTPIVKDANKKNIIEL
SREMKTLIKKAKDNKLTPIEFQGGGFTISNLGMYGIKNFNAIINTPQSCIMGVGASTKRA
IVKNDQIIIATIMDVTLSADHRVIDGAVSAEFLASFKRFIENPVLMLI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttgtctccaactatgagagaggggaatctagct
aggtggttaaaaaaagaaggggacaaagtaaatcccggggaagtaattgctgaaattgaa
actgataaagcaacaatggaagtagaatcagtagacgaaggtatacttgccaaaataatt
attccgcaaaatagtcaaaatgtacctgttaactctttaattgcagtattaagtgaagaa
ggagaagataaagcagatattgattcgtttattgcacaaaataatagtgtatcactatca
ctaaaaacagatgctactcttaagaaatcaaatgatagcataactaatatagaaggtata
aaacatgattccaataaaatatttgcctcaccacttgcaaaaaggcttgcaaaaattgga
gatattagacttgagaatgtgcaaggtagtggaccgcacggtagaatagtcaaacaagat
atattatcatatgattctagcacttcttctaataaaatagtgtatagagatactgaagaa
tatcgttcagtaccaaataataatatccgaaagattatagccaagcgtttgcttgaatcg
aaacaaacagttccacatttttatttatctatagaatgtaatgttgataaattattagat
gtaagggaagacattaataaatctttttctgaagataaagtaacaaagatatcggttaat
gattttataattttagctgtagccaaagctttacaagaagtgccaaatgctaatgctagc
tggtcagaagatgcgattagatattacaataatgtcgatatttcagtggcggtagcaatc
gagaacggtattgttacaccgatagttaaagatgctaacaaaaagaatattatagaacta
tctcgtgaaatgaaaacattaataaagaaagcaaaagataataaattaactcctatagaa
tttcagggtggaggatttacaatttctaatctcggaatgtacggtattaagaattttaat
gctattattaatacaccgcaaagttgtataatgggtgtcggagctagtacaaaacgtgct
atagtcaagaatgatcaaataatcatcgcaacaattatggatgttactctttctgccgat
caccgagtaatagacggagcagtaagtgctgagttcttggcatcatttaaaaggtttata
gagaatcctgttttgatgttgatataa

DBGET integrated database retrieval system