KEGG   Rickettsia prowazekii GvV257: MA5_03950Help
Entry
MA5_03950         CDS       T01791                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rpg  Rickettsia prowazekii GvV257
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rpg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1009613..1010605)
Genome map
AA seq 330 aa AA seqDB search
MYPLIRFRRNRKALWLRELIAESNLSISDLVLPLFVVEGHNEMQEIKTMPGIYRLSIDQI
VETAKKAADFGINAIALFPSIDHSLKSDNADEAYNLDNLICRTIIKIKNANIDIGIICDV
ALDPYTISGHDGIVHHGEVDNDRSVKALCNQALVLAKAGVDIVAPSDMMDGRIAAIREYL
DKEGFINVGILAYAAKYASSFYGPFRDAVQSNKKNYLDKSSYQIDMRNIKEAMLEIEHDI
AEGADIVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAETGAIDWERALIES
LISFKRAGATGIFTYAALEVAEILKHNNIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctcttattagatttagaagaaatagaaaagctttatggcttagagagttaata
gcagagagtaatttatcgattagtgatttagtgttacctttatttgttgttgaaggccat
aatgaaatgcaagaaattaagactatgcctggtatatatcgtttatcgatcgatcagata
gttgaaactgcaaaaaaagcagcagattttggtattaatgcgattgcattatttcctagt
attgatcacagtctaaaaagtgacaatgcagatgaggcatataatttagataatttaata
tgtagaactattataaaaatcaaaaacgccaatattgacattggtataatatgtgatgta
gcacttgatccttacactataagtggccatgatggtattgttcatcatggagaagttgat
aatgataggtcagtaaaagctttatgtaatcaagcattagtattagcaaaagctggagta
gatatcgttgcaccttctgatatgatggatggaagaatagcagctatcagggagtatctt
gacaaagaaggctttataaatgtaggaattcttgcttatgcagctaaatatgcttcaagc
ttttatggcccatttcgcgatgcagttcagagtaataaaaagaattatttagataaatca
agctatcaaattgatatgcgtaatattaaggaagcaatgcttgagattgagcatgatata
gcagaaggagcagatattgtaatggttaaaccaggtatgccgtttttggatgtgattcgt
gaagcggcaaataattttaatgctaaaatttttgcatatcaggttagtggggaatacgca
atgttaaaatttgcagcagaaacaggggctattgattgggagagagcgttaatagaatca
ttaattagttttaaacgtgccggtgcaacaggaatatttacctatgctgctcttgaagta
gctgaaatattaaagcacaataacattaagtag

DBGET integrated database retrieval system