KEGG   Rickettsia philipii: RSA_00920Help
Entry
RSA_00920         CDS       T01759                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rph  Rickettsia philipii
Pathway
rph00020  Citrate cycle (TCA cycle)
rph00190  Oxidative phosphorylation
rph00650  Butanoate metabolism
rph01100  Metabolic pathways
rph01110  Biosynthesis of secondary metabolites
rph01120  Microbial metabolism in diverse environments
rph01130  Biosynthesis of antibiotics
rph01200  Carbon metabolism
Module
rph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rph_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rph00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSA_00920
   00650 Butanoate metabolism
    RSA_00920
  Energy metabolism
   00190 Oxidative phosphorylation
    RSA_00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2 Fumarate_red_D Mem_trans Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AFB25792
UniProt: H6PW89
Position
168493..168870
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggca
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system