KEGG   Rickettsia philipii: RSA_01870Help
Entry
RSA_01870         CDS       T01759                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rph  Rickettsia philipii
Pathway
rph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rph00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSA_01870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 SDF
Motif
Other DBs
NCBI-ProteinID: AFB25970
UniProt: H6PSX3
Position
complement(340389..340916)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSAHQNTTALEQ
ALVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFVGISKPQNIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaaacccactctagagttacaacatcgc
ggctacagcgttgcggttcaagaatcatcagcacatcaaaatactaccgcactagagcaa
gcactggtaaatataccggaattaatgaagactgccaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcgagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaactaaaatgtcctttgtcggtatctcaaaaccacaaaac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system