KEGG   Rickettsia philipii: RSA_06570Help
Entry
RSA_06570         CDS       T01759                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rph  Rickettsia philipii
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rph00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112279..1112968)
Genome map
AA seq 229 aa AA seqDB search
MTTKNKRVLQKCAYREEFKGDMERSTAAMSKLPLEVELSRNSKGLIIILSSPSGTGKSSL
AKALLKIDNNLRLSISATTRKPRLGEVEGINYYFKTGLEFEELVKQNKFLEYAKIYDNYY
GTPKEYVEMLLNQGLDVLFDIDWQGARSIKKNATNVVAIFVLPPNIEVLEQRLRNRATDN
EEAIKLRMQSAQNEISHANEYDYVVTNDDFDRTLKKIHAIIVAARDKAF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaaataaaagggttcttcagaaatgcgcttatagagaggaatttaaagga
gacatggaacgtagcaccgcagcgatgtctaaattacctctagaagtagaactttcgagg
aactctaaaggactgattataattttatcttccccttcaggtacaggtaagtcgagttta
gctaaagcattattgaaaatagataataatttgcgtttatctatttcggcaactacaaga
aaaccacgtttaggagaagtagagggcataaactattactttaagaccggtctagagttt
gaagaattagttaagcagaataaattccttgaatatgctaaaatatacgataattattac
ggtacgcctaaagaatatgtcgaaatgttattaaatcaaggcttggatgttttgtttgat
attgattggcaaggagcacggagtattaagaaaaatgctactaatgttgttgctatattt
gtattgcctcctaatattgaagtattggaacaacgcttaagaaatagagcgaccgataat
gaagaagcaataaaattacgtatgcagtcggcacaaaacgaaatatcacatgctaatgag
tatgattatgtagttactaacgatgactttgaccggacgcttaaaaaaatacatgcgatt
atagttgcagcacgagacaaagcgttttga

DBGET integrated database retrieval system