KEGG   Rickettsia philipii: RSA_07430Help
Entry
RSA_07430         CDS       T01759                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rph  Rickettsia philipii
Pathway
rph00230  Purine metabolism
rph00240  Pyrimidine metabolism
rph01100  Metabolic pathways
rph03030  DNA replication
rph03430  Mismatch repair
rph03440  Homologous recombination
Module
rph_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rph00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RSA_07430
   00240 Pyrimidine metabolism
    RSA_07430
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RSA_07430
   03430 Mismatch repair
    RSA_07430
   03440 Homologous recombination
    RSA_07430
Enzymes [BR:rph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RSA_07430
DNA replication proteins [BR:rph03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RSA_07430
DNA repair and recombination proteins [BR:rph03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     RSA_07430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AFB26944
UniProt: H6PW43
Position
complement(1268573..1269037)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPE
DLKELTVKINKFTEQENKIDCFTQNPRGAWNKVV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattgcttctaaaatcgatattgctt
ctgatagaaaaatgctatcactctgatcttaaaagcgtgatattaactgcagatgcagat
caacaagaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaaacttgatccgcagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttgttattatttcgcctacagatataggaaaaatttta
caagcaaaagagtatataagagttttcaaaaggataattataataactgatttacccgaa
gatttaaaagaattaacagttaaaataaataaatttaccgaacaggaaaacaaaatagat
tgttttactcaaaatcctcgtggagcttggaataaagtagtctaa

DBGET integrated database retrieval system