KEGG   Ralstonia pickettii 12J: Rpic_0051Help
Entry
Rpic_0051         CDS       T00762                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00220  Arginine biosynthesis
rpi00330  Arginine and proline metabolism
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01130  Biosynthesis of antibiotics
rpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rpic_0051
   00330 Arginine and proline metabolism
    Rpic_0051
Enzymes [BR:rpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rpic_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACD25216
UniProt: B2UD37
Position
1:complement(63193..64122)
Genome map
AA seq 309 aa AA seqDB search
MTIIDLIGAAIGCGAQDDGCKDGPRALLEAGALGRLQTRDTHAALVHDIELAMSAGHSRS
ARLAALPGVAGFSRALGDATAHSVHQGHVPVVIGGDHSCAIGTWSGVANALRPRGPLGLI
WIDAHLDSHTPQTSDSGAIHGMPLAALLGHGAAALTQIRDAAPKLLPEHVVVIGARSYEP
AERALLDLLGVRVIDAAEVARNGLRAVMADAIRQVKSDTAAFGVTLDLDAFDPAVAPGVG
TPETDGLTAQGMAQALAACARDARFAAFELVEYNPRHDKGGITAHLALDLLASVAGALHA
QRREYATAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcattgatctgatcggcgcggccatcggctgcggagcgcaagacgacggctgc
aaggacggcccgcgcgcgctgctggaagccggcgcgctggggcgattgcagacgcgggac
acgcatgccgcgctcgtgcacgacatcgaactggcgatgtcagctgggcacagccgctca
gcacgcttggcggcgctcccaggcgtcgccggcttctcgcgcgcgctcggcgacgcgacc
gcgcacagcgtgcaccaggggcatgtgcccgtggtcatcggcggcgatcactcctgtgcc
atcggcacctggtcaggcgtcgcaaacgccttgcggccaaggggaccgcttggcctgatc
tggatcgacgcccatctcgacagccacacgccgcagacgagcgattccggcgccatccac
ggcatgccgctggcggcgctgctcggccacggagcagcggccctcacgcagatccgcgat
gccgcgccgaagctgctgccggaacacgtggtggtgatcggcgcgcgcagctacgagccc
gccgaacgcgcgttgcttgacctgcttggcgtgcgcgtcatcgacgcagccgaagtcgca
cgcaatggtctgcgcgccgtcatggccgacgccatccgccaagtcaaatcggacacggcc
gcctttggcgtgacactcgatctggacgcctttgaccccgccgtcgcgccgggcgtcggc
acgcccgaaacagacgggctcaccgcgcagggcatggcgcaagcactcgccgcgtgcgca
cgcgacgcacggtttgccgcattcgaactggtggaatacaacccgcgccacgacaagggc
gggatcacggcacatctggccctggacctcctggccagcgtcgcaggcgcattgcacgcc
cagcgccgcgaatacgcgacggcggcttga

DBGET integrated database retrieval system