KEGG   Ralstonia pickettii 12J: Rpic_0209Help
Entry
Rpic_0209         CDS       T00762                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic_0209 (gpmA)
   01230 Biosynthesis of amino acids
    Rpic_0209 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_0209 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Rpic_0209 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic_0209 (gpmA)
Enzymes [BR:rpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rpic_0209 (gpmA)
Exosome [BR:rpi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rpic_0209 (gpmA)
  Exosomal proteins of melanoma cells
   Rpic_0209 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(227340..228095)
Genome map
AA seq 251 aa AA seqDB search
MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGVAQARQGGKLLREAGFTFDLAYTSV
LKRAIRTLWHVQDEMDLMWIPTRNEWRLNERHYGALSGLNKAETAAQYGDEQVLVWRRSY
DTPPPALEPGADNDAFGNPRYAGLTREQVPLTECLKDTVARVMPLWEESIAPAIKSGKRV
VIAAHGNSIRALVKYLDGISDADIVGLNIPNGTPLVYELDANLKPIRHYYLGDQEAIAAS
LAAVASQGKSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgcataagctcgtcctcatccgccacggcgaatcgacgtggaatctggag
aaccgtttcaccggctgggtcgacgtcgacctgaccgacacgggcgtcgcccaggcccgc
caaggcggcaagctgctgcgcgaagccggcttcacgttcgatctggcctacacctcggtg
ctcaagcgcgcgatccgcacgctctggcacgtgcaggacgaaatggacctgatgtggatc
ccgacccgcaacgaatggcgtctgaacgagcgtcactacggggcgctgtcgggcctgaac
aaggcagaaaccgccgcgcaatatggcgacgagcaagttctcgtctggcgccgcagctac
gacacgccgccgcccgcgctggagcccggcgccgacaacgacgccttcggcaacccgcgt
tacgcgggactcacgcgcgagcaggtgcccctgaccgaatgcctgaaggacaccgtcgca
cgcgtcatgccgctgtgggaagaatcgattgcaccggccatcaagagcggcaagcgcgtg
gtgatcgccgcgcacggcaacagcattcgcgcgctggtgaagtacctggacggcatctcc
gacgcggacatcgtcggcctgaacattcccaacggcacgccgcttgtgtatgagctggac
gccaacctcaagccgatccgccattactacctgggcgaccaggaagcgattgccgcgtcg
ctcgcggcggtggccagccaaggcaagtcgaaataa

DBGET integrated database retrieval system