KEGG   Ralstonia pickettii 12J: Rpic_0209Help
Entry
Rpic_0209         CDS       T00762                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00010  Glycolysis / Gluconeogenesis
rpi00260  Glycine, serine and threonine metabolism
rpi00680  Methane metabolism
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01200  Carbon metabolism
rpi01230  Biosynthesis of amino acids
Module
rpi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rpi_M00002  Glycolysis, core module involving three-carbon compounds
rpi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_0209
  Energy metabolism
   00680 Methane metabolism
    Rpic_0209
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic_0209
Enzymes [BR:rpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rpic_0209
Membrane trafficking [BR:rpi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rpic_0209
Exosome [BR:rpi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rpic_0209
  Exosomal proteins of melanoma cells
   Rpic_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACD25372
UniProt: B2UE32
Position
1:complement(227340..228095)
Genome map
AA seq 251 aa AA seqDB search
MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGVAQARQGGKLLREAGFTFDLAYTSV
LKRAIRTLWHVQDEMDLMWIPTRNEWRLNERHYGALSGLNKAETAAQYGDEQVLVWRRSY
DTPPPALEPGADNDAFGNPRYAGLTREQVPLTECLKDTVARVMPLWEESIAPAIKSGKRV
VIAAHGNSIRALVKYLDGISDADIVGLNIPNGTPLVYELDANLKPIRHYYLGDQEAIAAS
LAAVASQGKSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgcataagctcgtcctcatccgccacggcgaatcgacgtggaatctggag
aaccgtttcaccggctgggtcgacgtcgacctgaccgacacgggcgtcgcccaggcccgc
caaggcggcaagctgctgcgcgaagccggcttcacgttcgatctggcctacacctcggtg
ctcaagcgcgcgatccgcacgctctggcacgtgcaggacgaaatggacctgatgtggatc
ccgacccgcaacgaatggcgtctgaacgagcgtcactacggggcgctgtcgggcctgaac
aaggcagaaaccgccgcgcaatatggcgacgagcaagttctcgtctggcgccgcagctac
gacacgccgccgcccgcgctggagcccggcgccgacaacgacgccttcggcaacccgcgt
tacgcgggactcacgcgcgagcaggtgcccctgaccgaatgcctgaaggacaccgtcgca
cgcgtcatgccgctgtgggaagaatcgattgcaccggccatcaagagcggcaagcgcgtg
gtgatcgccgcgcacggcaacagcattcgcgcgctggtgaagtacctggacggcatctcc
gacgcggacatcgtcggcctgaacattcccaacggcacgccgcttgtgtatgagctggac
gccaacctcaagccgatccgccattactacctgggcgaccaggaagcgattgccgcgtcg
ctcgcggcggtggccagccaaggcaagtcgaaataa

DBGET integrated database retrieval system