KEGG   Ralstonia pickettii 12J: Rpic_0251Help
Entry
Rpic_0251         CDS       T00762                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00900  Terpenoid backbone biosynthesis
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rpic_0251
Enzymes [BR:rpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rpic_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACD25413
UniProt: B2UER7
Position
1:complement(265262..266131)
Genome map
AA seq 289 aa AA seqDB search
MSSAPVELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWSDTLHFARRPDRRLVRT
TDILGVPADDDLVIRAARLLQAETGCTYGVDIAIEKRLPMGGGLGGGSSDAATTLLALNR
LWGLDLPRAQLMKIGLKLGADVPFFVFGQNAFAEGIGEKLTPITLPPAAFVVIHPRVHVP
TPAIFSDEGLTRDTPLTIITDFPDQQIVFAYGRNDLQAVAERKYGEIARALVWLRQFSPL
ARMTGSGACVFAPFDNVEHAQAVADQVPSEWEGRCAAGLTHHPLARFAV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcccccgtcgagctgcgtgattgccccgcgcctgccaagctcaatctcttc
ctgcatgtagtcggccgccggcccgatggctaccacctgctgcaaaccgtcttccagttg
atcgactggagcgacacgctgcatttcgcgcgccgccccgaccgccgcctcgtgcgcacc
accgacatcctcggcgtgcccgccgatgacgaccttgtgatccgcgccgcgcgcctgctg
caagcggaaaccggctgcacctacggcgtcgacatcgccatcgagaaacgcctgccgatg
ggcggaggccttggtggtggctcgtctgatgccgccaccacgctgctcgcgctcaatcgc
ctttggggccttgatctgccgcgcgcgcaactgatgaagatcggcctcaagctcggcgcc
gacgtgcccttctttgtattcggccagaacgccttcgccgaggggatcggcgaaaaactc
acgcccatcacgctgccgccggctgcgttcgtggtgattcacccacgcgtgcatgtgccc
acccctgcaattttttcagatgaagggttgacacgcgatacgccactcaccataattacg
gactttcctgaccaacaaattgttttcgcttacggtcgcaacgatctacaagcggtggcg
gaaaggaaatacggcgaaatcgcccgagcacttgtctggctgcgtcagttcagccctctg
gcaagaatgaccggatccggcgcctgcgtatttgctccgttcgacaacgttgagcatgcg
caagcggtggcggatcaggtgccttccgaatgggaaggtcggtgtgcggcaggtctgacg
catcacccgctcgcaagatttgctgtgtaa

DBGET integrated database retrieval system