KEGG   Ralstonia pickettii 12J: Rpic_0254Help
Entry
Rpic_0254         CDS       T00762                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rpi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:268808..269683
Genome map
AA seq 291 aa AA seqDB search
MPELPEVEVTRLGLLPHITGRRIVRAVVRHHGLRWPVDPALPELLAGLTVTRLLRRGKYL
LIECVPEVEQSGRAADTVGGWLLIHLGMTGTLRVLETPVPPGLHDHVDIELAGATGVHVT
LRYRDPRRFGAVLWHAGDEAGLAEHPLLRNLGIEPFDARFDGDWMFARTRGRRVAIKSAL
LAGDIVVGVGNIYCSESLFRAGIRPTTAAGRISRPRYAALADAIRATLADAIARGGSTLR
DFVGSDGQSGYFQLEAFVYDRAGLPCRACGTPIRQIVQGQRSTFCCPTCQR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgccggaggtcgaggtcactcgcctgggcttgctaccgcatattactggg
cgacgtatcgtgcgcgccgtggtgcgccatcacggcttgcgctggcccgtcgatccggcg
ctgccggagttgctcgctggcctgaccgttacgcgtctgctgcgccggggcaaatacctg
ctcatcgaatgcgtgcccgaggtggagcagtccggccgcgccgccgatactgtggggggc
tggctgctcatccatcttgggatgacgggcaccttgcgcgtgctggaaacgcccgtgccg
ccaggcctgcacgatcacgtcgatatcgaactcgccggcgcaactggcgtacacgtcaca
ctgcgctatcgcgacccgcgccggtttggtgccgtgctttggcatgcaggcgatgaagcc
ggcttggccgaacacccgctgctgcgcaacctcggcatcgagccgttcgacgcgcgattc
gacggcgactggatgtttgcccgcacgcgcgggcgccgggtggccatcaagtcggcgctg
ctggccggcgacatcgtggtcggcgtgggcaatatctattgttcggagagcctgtttcgc
gccggtatccggccgactacggcggcgggccgcatcagccggccacgctatgcggcgttg
gccgatgccattcgtgccaccttggccgatgccatcgcgcgtgggggcagcacgctgcgc
gactttgtcggctcggacggacaaagcggctacttccagcttgaagccttcgtgtacgac
cgcgccggtctgccgtgccgcgcgtgcggcactccgatccgccagatcgtgcagggccag
cgctccacgttctgttgcccgacctgccagcgctga

DBGET integrated database retrieval system