KEGG   Ralstonia pickettii 12J: Rpic_0536Help
Entry
Rpic_0536         CDS       T00762                                 

Definition
Cache sensor-containing methyl-accepting chemotaxis sensory transducer
Orthology
K03406  
methyl-accepting chemotaxis protein
Organism
rpi  Ralstonia pickettii 12J
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpic_0536
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rpic_0536
Bacterial motility proteins [BR:rpi02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Rpic_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:572030..573859
Genome map
AA seq 609 aa AA seqDB search
MGVVVGNHTVLASIRTRILLTCVAIVVGALTFAGGLNYLVTRSYNDESIRQNLQSVARGH
IAGIDDWVASKTQMMVSLQDVAVSADPIPVFKAVHKAGGFINVYVGYPDKSYKFSNPEGI
PPTYDPTARPWYKQAVEAGKPVVTPPYVSASTGQLVVTFAVPILEGGALKGVIGGDVAMD
SVIANVKAIHPTQASFGFLVNAAGKIVAHPNDKLTLKPATELAAGLNEATLASLAQAERP
VEVTVDGASKLLYRQGVKGTDWGLVVALDKSDATAGMRSLVMTSIGALVGVAIVAALIVG
AMTARAFRRLSMIRDAMDDIGSGSGDLTKRLPSDGEDEVAQIARSFNAFADKLTAVMQQI
RLGSDSVRSAAQEIAAGNADLSQRTEEQASSLEETASSMEELTSIVKQNADNARQASQLA
VTASDVATRGGNVVGQVVQTMGGINESSKKIADIIGVIESIAFQTNILALNAAVEAARAG
EQGRGFAVVASEVRSLAQRSAGAAKEIKALISDSVDRVSNGTALVDQAGVTMAEIVDAVK
RVTDIMGEISSASEEQSSGIEQVNQAVNQMDQVTQQNAALVEQAAAAAESLEEQAHNLNE
AVGQFRLSH
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcgtagtaggaaaccataccgtgcttgcatccatccgtactcgcattttgctg
acctgcgttgccatcgtggtcggcgcattgacctttgccggcggtctcaactatctcgtg
acgcgctcgtacaacgacgagtccatccgccagaacctgcagtccgtcgcgcggggccac
atcgctggcatcgacgactgggtggcgtccaagacgcagatgatggtgtcgctgcaagac
gtggcggtgtctgccgatccgattccggtcttcaaggccgtgcacaaggctggcggcttc
attaacgtctatgttggctatcccgacaagtcgtacaaattctcgaaccccgaaggcatt
ccgccgacgtatgacccgaccgcgcgcccctggtacaagcaggcggtggaggcgggcaag
cctgtggtgacgccgccgtacgtgagcgccagcaccggccagctcgtggtgactttcgca
gtgcccattctggaaggcggcgcgctcaagggcgtgattggcggcgacgtggcaatggac
agcgtgatcgccaacgtgaaggccatccatccgacgcaggcgagcttcggtttcctcgtc
aacgctgcgggcaagatcgttgcgcacccgaatgacaaactcacgctcaaaccggcaact
gagctggcggcagggttgaacgaagccacactggcatcgctggcacaagccgagaggccc
gtggaagtgacggtggatggggcgtccaagctgctctaccgccagggcgtgaagggcacc
gactggggcctggtggtggcgctggacaagtctgacgccaccgcgggtatgcgctcgctg
gtgatgacgtcgattggcgcgctggtgggcgtggccatcgttgcagcactcatcgtcggt
gcaatgacggcacgcgcgttccgccgcctgtcgatgatccgtgatgcaatggacgacatc
ggctcgggcagcggcgacctcaccaagcgtctgccgtcggacggcgaagacgaagtcgcg
cagatcgcccgttcgttcaatgcgtttgccgacaagctcacggcggtgatgcagcagatc
cgcctgggcagcgattcggtgcgctcggccgcgcaggaaattgccgccggcaacgcagac
ctgtcgcagcgcacggaagagcaggccagctcgctggaagaaaccgcgtcgagcatggaa
gaactgacgagtatcgtgaagcagaacgccgacaacgcgcgtcaggccagccagcttgcc
gtcacggcgtcggacgtggccacgcgcggcggcaacgtggtcggccaggttgtgcagacc
atgggcggcatcaacgagagcagcaagaagattgccgacatcatcggcgtgatcgaaagc
atcgccttccagaccaacatcctggcgctgaacgcggcggtggaagccgcgcgtgccggc
gagcagggccgcggctttgccgtggtggccagcgaagtgcgcagcctggcgcagcgttcg
gccggtgcggccaaggaaatcaaggcgctgatcagcgactcggtggatcgtgtgagcaac
ggcacggcgctggtggatcaggccggcgtgacgatggccgagatcgtggatgcagtgaag
cgcgtgaccgacatcatgggcgagatttcatcagcgtcggaagagcagagcagcggcatc
gagcaggtcaaccaggccgtcaaccagatggaccaggtgacgcagcagaacgccgcgctg
gtcgagcaggcggctgccgctgcggaatcgctggaggaacaggcccacaacctgaacgag
gcagtggggcagttccgcttgtcgcactaa

DBGET integrated database retrieval system