KEGG   Ralstonia pickettii 12J: Rpic_0641Help
Entry
Rpic_0641         CDS       T00762                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_0641
   00030 Pentose phosphate pathway
    Rpic_0641
   00051 Fructose and mannose metabolism
    Rpic_0641
   00052 Galactose metabolism
    Rpic_0641
   00500 Starch and sucrose metabolism
    Rpic_0641
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic_0641
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic_0641
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rpic_0641
Enzymes [BR:rpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rpic_0641
    5.4.2.8  phosphomannomutase
     Rpic_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:680570..681958
Genome map
AA seq 462 aa AA seqDB search
MTQLNPTIFKAYDIRGIVEKTVDAETARLIGRAFGSAARAKGESAVVIGRDGRLSGPNLL
AALADGLRASGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVL
AGQAIYGEQIQALRTRIEQGDFTEGAGDYVQVDIRQQYIDRIISDVKVSRPMKIAVDCGN
GVAGAFAPELFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAF
DGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKA
TMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRLADPSA
TLNALPNSHCTPELQLKCAEGESFELLDKIKANATFTGAKEVNRIDGVRVEYEDGFGLAR
PSNTTPVVVMRFEADNDAAMARIQGEFRRVILAEKPDAQLPF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacacaactgaaccccaccatcttcaaagcctacgacatccgcggcatcgtcgaaaaa
accgtcgatgccgaaaccgcacgcttgatcggccgtgccttcggctccgcagcacgcgcc
aagggcgaatccgccgtcgtcatcggccgtgatggtcgcctgtccggccctaatctgctc
gcagcgctggcagacggcctgcgcgcgagcggcgtcgatgtgatcgacctgggccttgta
gccacgccgatggtctacttcggcactaacatcgaattggccggccgtcgcgccacgtcg
ggcgtgatggtcaccggcagccacaacccgcctgactacaacggcttcaagatggtcctg
gcgggccaggccatctacggcgagcagatccaggcgctgcgcacgcgcatcgaacagggc
gacttcacggaaggcgccggcgactacgtccaggtggacatccgccagcaatacatcgac
cgaatcatctcggatgtcaaggtgagccgcccgatgaagattgccgtggactgcggcaac
ggcgtggcaggcgcttttgcgccggagttgttccgcgcgatgggctgcgaggtgacggag
ctgttctgcgaggtggatggccatttcccgaaccaccatccggacccggcccacgtcgag
aacctgcaggacctcgtgcgcacgctgcagaccacggattgcgaacttggcctcgccttc
gatggcgatggtgaccgcctgggcgtggtgaccaaggacggtcaggtcattttccctgac
cgtcagttgatgttgttcgcgcaggaagtcctgtcgcgcaacccgggcggcgagatcatc
ttcgacgtgaagtgcacaggcaagctggcgccgttcatccgtgagcacggcggcaaggcc
acgatgtggaagaccggccattcgctggtcaaggcgaagctaaaggaaacgggtgcgcca
ctggccggcgagatgagcggccacattttcttcaaggaccgctggtacggtttcgatgac
ggtctgtacacgggcgcgcgcctgctagagatcgtctcgcgtctggccgacccgagcgct
acgctcaacgcgctgccgaactcgcactgcacgccagagctgcagctgaagtgtgccgag
ggtgaatcgttcgagctgctcgacaagatcaaggccaatgccacgtttaccggcgcgaag
gaagtcaaccgcatcgatggcgtgcgcgtggaatacgaagatggcttcggcttggcgcgt
ccgtccaacaccacgccggtggtggtgatgcgcttcgaggctgacaacgatgctgcgatg
gcgcgcatccagggtgaattccgccgcgtgatcctggccgaaaagccggacgcgcaactg
ccgttctga

DBGET integrated database retrieval system