KEGG   Ralstonia pickettii 12J: Rpic_0798Help
Entry
Rpic_0798         CDS       T00762                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpic_0798
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rpic_0798
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpic_0798
Enzymes [BR:rpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rpic_0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:844909..846528
Genome map
AA seq 539 aa AA seqDB search
MSDQPIFKPTRRTLIKGLVSASGTALLSSRIGDVLAQGAAPAAMTSERLRPQVPGGVMSG
DITAGSAIVWSRTDRPARMIVEYSTDAAFKNVARRIGPAALESNGLTARVDLNGLPAGAD
LFYRVRFQDLVHDKAFSEPVAGRFRTAPMQANRPICFVFSGDEAGQGWGINERFGGYRLY
EAMRRESPDFFIHSGDQIYADGPIQAEVKLPDGALWTNLVTEAKSHVAQTLDDYRGAFAY
NQLDKNKRAFSAEVPFLVQWDDHEVRNNWYPGQQIGPEEKRYQERSASLLAARAKQAMFE
YNPFRFNPIDPEQIYRAFQYGPLLDVFMLDERSYRGRNSPNRQTRLDADSAFLGPAQAAW
LKQSLKQSKATWKVIASDMPISLVVPDLNPDVPKGTYEAWANADDGMPSGRELELAEILR
FIKQENIQNVVWVTADVHYAQATYYHPSRAKFTDFKPFWEFVGGPINAGTFGPNEVDQTF
GPDVRYVSIPKDNPQNQSPAALQQYYGRAKIDPITRTMHVSLHDLDGKSLWEVKLDPEA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccagccgatcttcaagccgacccgccgcacgctgatcaaaggcctcgtttcc
gccagcggcaccgcgctcctcagctcgcgtatcggcgacgtgctggcccagggcgccgca
ccggccgcaatgacgtccgagcgcctgcgcccgcaagtgccaggcggcgtgatgagcggt
gatatcacggccggcagcgccatcgtctggagccgcaccgatcgtccggcacgcatgatc
gtcgaatactcgacggacgccgccttcaagaacgtcgcgcgtcgcatcggccccgcggcc
cttgaaagcaacggcctgacagctcgggtcgacctgaacggcctgccagccggcgcagac
ctgttttaccgcgtgcgcttccaggacctcgtgcacgacaaggccttcagcgagccggtt
gccggtcgcttccgcacggcacccatgcaggccaatcgccccatctgctttgtcttctct
ggcgacgaggccggccaaggctggggcatcaacgagcgcttcggcggctatcgtctgtat
gaggcaatgcgccgcgaatcgcccgacttcttcatccactccggcgatcagatctatgcc
gacggcccgatccaggccgaggtgaaactgcccgacggcgcgctgtggaccaacctcgtt
accgaggccaaatcgcacgttgcacagacgctcgacgactaccgcggcgcctttgcctac
aaccagctggacaagaacaagcgcgcgttttccgccgaagtgccgttcctcgtgcagtgg
gacgaccacgaggtgcgcaacaactggtaccccggccagcagatcggcccggaagagaag
cgctatcaggagcgcagcgcatcgctgctggcggcccgcgcgaagcaggcgatgttcgag
tacaacccgttccgcttcaatccgatcgacccagagcagatctaccgcgcgttccagtac
ggcccgctgctcgacgtattcatgctggacgagcgcagctatcgcgggcgcaattcgccg
aaccgccagacccggctggatgccgattcggccttcctcggcccggcacaggcggcgtgg
ctcaagcaatcgctcaagcagtcaaaggcgacgtggaaggtgattgccagcgacatgccg
atctcgctggtggtgcctgatctgaaccccgatgtgcccaagggcacctatgaagcgtgg
gccaatgcggatgacggcatgccgtcgggccgcgaactggagttggccgagatcctgcgc
ttcatcaagcaggaaaacatccagaacgtggtctgggtgacggctgacgtgcactacgcg
caggctacgtactaccacccgtcgcgcgccaagttcacggatttcaaaccgttctgggag
ttcgttggcggccccatcaacgcgggcaccttcggaccgaatgaagtggaccagacgttt
ggaccggacgtgcgctacgtcagcattccaaaggacaatccgcagaaccagtcgcccgcg
gcgctgcagcagtattacggtcgcgccaagatcgacccgatcacgcgcacgatgcacgta
tcgctgcacgatctcgacggcaaatcgctctgggaagtgaagctcgatcccgaggcgtag

DBGET integrated database retrieval system