KEGG   Ralstonia pickettii 12J: Rpic_0933Help
Entry
Rpic_0933         CDS       T00762                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rpi  Ralstonia pickettii 12J
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic_0933
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Rpic_0933
Enzymes [BR:rpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rpic_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:985834..986883
Genome map
AA seq 349 aa AA seqDB search
MTQTKKQKRPGPIVLDVAGLELGLDDVRRIAHPLTGGVILFARNFESRAQLTALTQAIRA
IRNDVLICIDHEGGRVQRAKTDGFTHLPAMGALGKLWDADVLAATRAATACGYVLAAELR
ACDIDLSFTPVLDLDYGSSSVIGDRAFHRDPRVVTMLANHLTLGLRLAGMSNCGKHFPGH
GYVQADSHVAVPVDERPLEAILADDAQPYGWMGIGLQSVMPAHVIYSAVDPNPAGFSRFW
LQDMLRAHFNFDGVIFSDDLSMEGASVAGTVVDGARAALTAGCDMVLICNAPDKADQLLG
ELDVSMGKASQRRVRRLFGGRAEKDWAKLQQQSAYKQALRTLREAKLIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaccaagaagcagaagcgtccaggcccgatcgttctggatgttgccggcctg
gaactcggcctcgacgatgttcgacgcattgcccatccattgacgggcggcgtgatcctg
tttgcccgcaactttgaatcgcgcgcgcagttgacggcgctcacgcaagccattcgcgcc
attcgtaatgacgtgctgatttgcatcgaccacgaaggcggtcgcgtgcagcgcgccaag
accgacggtttcacgcacctgcccgccatgggcgcgctgggcaagctatgggacgccgat
gtgctggccgccacgcgcgctgccaccgcctgcggctacgtgctggccgctgaactgagg
gcgtgcgatatcgacctcagcttcacgcccgtgctcgatctcgactacggcagcagcagc
gtgatcggcgatcgcgcgtttcatcgcgacccgcgggtggttacgatgcttgccaaccac
ctgacgctgggcctgcgcctggctggcatgtccaactgcggcaagcatttccccggtcac
ggctacgtccaggctgattcgcacgtcgccgtgccggtggacgagcgtccgctggaggcc
atcctcgctgacgacgcgcagccttacggctggatgggcatcggcctgcaatccgtgatg
ccggcgcacgtgatttattcagcggtcgatccgaacccggcaggcttctctcgcttctgg
ctgcaggacatgctgcgcgcgcatttcaactttgacggcgtgatcttcagcgatgacctg
agcatggaaggcgcgagcgttgccggcacggtggtcgacggtgcgcgagcagcgctcacg
gccggctgcgacatggtgctgatctgtaatgcgccggacaaggccgatcaattgctcggc
gagctggacgtgtcgatgggcaaggcatcgcagcggcgcgtgcgccggctgtttggcggc
cgggccgagaaggactgggccaagttgcagcagcaatcggcctacaagcaggcgctgcgt
acgttgcgcgaggcgaaactcatcgcgtag

DBGET integrated database retrieval system