KEGG   Ralstonia pickettii 12J: Rpic_1038Help
Entry
Rpic_1038         CDS       T00762                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rpi  Ralstonia pickettii 12J
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rpic_1038 (recR)
DNA repair and recombination proteins [BR:rpi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rpic_1038 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1103894..1104514
Genome map
AA seq 206 aa AA seqDB search
MRNAPGTPSALQMLVEALRVLPGVGPKSAQRMAYHLMQHDREGAAQLAQALSEATESIQH
CSRCNTFTEQEVCETCLDTRRDASVLCVVETPADQMMIEQTLTYRGQYFVLMGRLSPLDN
IGPKEIHLERLLARATDPALGGPCTEVILATNFTSEGEATAHYIGEMLKARGIKATRLAR
GVPVGGELEYVDAGTIARAVLDRRQL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacgctccaggcacgccgtcggcgctgcagatgctggttgaagccttgcgcgtg
ctgccgggcgtgggccccaagtctgcccagaggatggcgtatcacctgatgcagcatgac
cgcgagggggcggcgcagctggcacaggcgctgtctgaggcaacggaatcgatccagcac
tgcagccgctgcaatacctttaccgagcaggaagtttgcgagacctgcttggacacgcgc
cgcgatgcatcggtcctgtgcgtggtggaaacgcccgctgatcagatgatgatcgagcag
acgctgacctatcgcggccaatacttcgtgctgatggggcggctctcgccgctggacaac
atcggcccgaaagagatccacctcgaacgcttgctggcccgtgcgaccgatcctgcgctg
ggcgggccgtgcaccgaggtcatcctcgcaaccaacttcaccagcgaaggtgaggcgaca
gcccattacattggcgagatgttgaaggcgcgcggcatcaaggcgacgcgtcttgcgcgt
ggcgtgccggtaggcggtgagctggaatacgtggacgcgggtaccatcgctcgcgccgtg
ctggaccggcgccaactctga

  All links  
No link information was found.   
DBGET integrated database retrieval system