KEGG   Ralstonia pickettii 12J: Rpic_1049Help
Entry
Rpic_1049         CDS       T00762                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpi  Ralstonia pickettii 12J
Brite
Enzymes [BR:rpi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rpic_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1115012..1115956
Genome map
AA seq 314 aa AA seqDB search
MSERPRDRRFPLTLDAVVERKPVERQRETRISSGVSAVSRPTPVRAASVERASPASAPAP
APQRVAGVDAAVGAVAASAVQARTAAAHAAAGGMASDRARQALVGRVQAGGVSDKRVLAA
IGTVPRHLFVDAGLASQAYEDSALPIGHQQTISKPSVVGRMIELLLSGRSGRTGMPLARV
LEIGTGCGYQAAVLAQLADEVYSIERVRPLHEKAKANLRPLRVPNIRLHYGDGMLGLPKA
APFDAIILAAAGLEVPQALLDQLTVGGRLIAPVATDRNSGPAQQLVLIERRSRFEFHSTA
LEGVFFVPLKSGTV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgcccgcgcgatcggcgcttcccgttgacgctcgacgcggtggtcgagcgt
aagcccgtggagcgccagcgtgagacgcgtatctcgtctggggtgagcgcggtgtcacgt
cccacgccggtgcgtgcggcatccgtcgaacgcgcgtcacccgcatccgcccccgcacct
gcgccgcaacgcgtggcgggggtcgacgctgcggtcggcgccgtcgctgcgagcgccgtg
caggcacgcacggcggcagcgcatgcggcggcgggcggcatggcgtcggaccgcgcgcgt
caggcattggttggccgggtgcaagcaggtggcgtgagtgacaagcgcgtgctggcagca
atcggcactgtgccacgccatctgttcgtcgatgccggcctggcgtcgcaggcgtatgag
gattccgcattaccgatcggccatcagcaaacgatctcgaagccgtcagtggtcggacgg
atgatcgagttgttgttgagtggacggtcgggccgcaccggcatgccgctggcacgtgtg
ctggaaattggcaccggctgcggctaccaggcagccgttctggcgcaactcgccgacgag
gtgtactccatcgagcgcgttcgcccgctgcacgaaaaagccaaagcgaacttgcggcca
ctccgcgtgccaaacatccgtctgcactatggcgacggcatgctggggctgccgaaggcc
gcgccgttcgacgccatcatcctggcggcggcggggctggaggtgccgcaggcgttgctc
gaccagctgaccgtcggcggccggctgatcgcccccgttgccaccgaccgcaacagcggt
ccggcgcagcagctcgttctcattgagcgtcgcagccgcttcgagtttcacagtaccgcg
cttgaaggcgttttctttgtcccgttaaaatcaggaactgtttag

DBGET integrated database retrieval system