KEGG   Ralstonia pickettii 12J: Rpic_1098Help
Entry
Rpic_1098         CDS       T00762                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic_1098
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpic_1098
  Amino acid metabolism
   00310 Lysine degradation
    Rpic_1098
Enzymes [BR:rpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rpic_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1172093..1173343
Genome map
AA seq 416 aa AA seqDB search
MAIVEVKVPQFSESVEEGTLISWKKKPGEAVAQDEILIEVETDKVVLEVPAPSAGVLAEV
LVADGATVTSEQLLAKIDTEGKAGAAAPAAAAPAPAAAAPAPVAAPAAAATGGVAMPSAA
KLMAENNLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAAAAAPQAARPALQQVAAPVDFA
ALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQFEKTHG
VKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQ
MSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAILGVH
ATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaggtcccgcagttttccgagtccgttgaagaaggcacgctg
atctcctggaagaagaagccgggcgaagccgtggcccaggacgaaatcctgatcgaagtc
gagaccgacaaggtcgtgctggaagtgccggccccgtcggctggcgtgctggctgaagtg
ctggtggctgacggcgcaaccgtgacgtcggagcagctgctggccaagatcgacaccgaa
ggcaaggcaggcgccgccgctccggctgctgctgctccggctcccgcagccgctgcaccg
gcaccggttgctgctccggccgccgccgctacgggtggcgtggccatgccgtcggctgcc
aagctgatggctgagaacaacctgtcggctggccaggtggccggcacgggccgcgatggc
cgcatcaccaagggcgacgtgctgggtgccgtagccggtggcgccaagccggctgctgct
gccgctccgcaggctgcacgtccggcgctgcagcaagtggctgcaccggtggacttcgcc
gccctgggcgaccgtccggaagagcgcgtgccgatgagccgcctgcgcgcccgtattgcc
gagcgcctggtgcagtcgcaatcgaccaacgccatcctcaccaccttcaacgaagtcaac
atgaagccggtgatggacttgcgcgccaagttcaaggaccagttcgagaagactcacggc
gtgaagctgggcttcatgtcgttcttcgtgaaggcggctgtccacgcgctgaagaagtac
cccgtgatcaacgcatcggttgacggcaacgacatcgtctaccacggctacttcgacatc
ggtatcgctgttggctcgccgcgcggcctggtggtgcccatcctgcgcaatgccgaccag
atgagcctggccgatatcgagaagaagattgctgaattcggccagaaggccaaggacggc
aagctgacgctggacgacctgaccggcggtacgttctcgatctcgaacggcggcacgttc
ggctcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatcctgggcgtgcac
gccaccaaggatcgcgccgtagtggagaacggccaggtcgtggttcgcccgatgaactac
ctggccatgtcctacgaccaccgcatcatcgacggccgcgaagccgttctgggtctggtg
gcgatgaaggaagcgctggaagacccggcccgcctgctgctggatctctaa

DBGET integrated database retrieval system