KEGG   Ralstonia pickettii 12J: Rpic_1203Help
Entry
Rpic_1203         CDS       T00762                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpic_1203
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic_1203
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rpic_1203
Enzymes [BR:rpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rpic_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1290748..1292193
Genome map
AA seq 481 aa AA seqDB search
MQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSVDELTRWRDLPYADLAFEILR
KFATDIPEDDLRALTRRTYTPEVYSNARAGDNTADITPLHKLGEEGGTSLSLLCLSNGPT
LAFKDMAMQLLGNLFEYALDREHAELNILGATSGDTGSAAEYAMRGKRGVRVFMLSPHRK
MSAFQTAQMFSLQDKNIFNIAIEGVFDDAQDIVKAVSNDLEYKARQKIGTVNSINWARVV
AQVVYYFKGYLLAAPKIGDKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGTYRVRSAAQTYHTSSPSMDISKASNFERFVFDLLDRDPARLAQLFRDVDEKGGF
SMTGKPEFDRIAEFGFVSGRSSHEDRVDTIRDVFATYGTMIDTHTADGVKVARENLTPGV
PMVVLETALPAKFGDTIREALDREPERPAGYADIESLPQRFEVMPADADRIKVYIAQHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccgatcgacccgcggccacgcagagccgcaaagcttctcccgcatcctgctg
ggcggcctggcgccggacggtggcctgtacctgcctgagcaatacccgcaagtcagcgtt
gatgaactgacccgctggcgcgacctgccgtacgccgacctcgcgttcgaaatcctgcgc
aagttcgccaccgacattcccgaggatgacctgcgcgcactgacccgccgcacctacacg
cctgaggtctacagcaacgcgcgcgccggcgacaataccgccgacatcacgccgctgcac
aagctgggcgaggagggcggcacgtcgctgtcgctgctgtgcctgtccaacggcccgacg
ctggccttcaaggacatggcgatgcagctgctgggcaacctgttcgaatacgcgctcgac
cgtgaacacgccgagctgaacatcctcggcgccacctccggcgacacgggcagcgcagcc
gaatacgcgatgcgcggcaagcgcggcgtgcgtgtattcatgctgagcccgcatcgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaagacaagaacatcttcaacatc
gccatcgaaggcgtgttcgacgacgcgcaggacatcgtcaaggcggtgtcgaacgatctc
gaatacaaggcacgccagaagatcggcacggtcaactcgatcaactgggcgcgcgtcgtc
gcccaggtcgtctactacttcaagggctacctgctggctgcccccaagattggcgacaag
gtgtcgttctgcgtgccgtcgggcaatttcggcaatgtttgcgcgggccacatcgcacgc
atgatgggtttgccgatcgacaagctggttgtggccaccaacgagaacgacgtgctcgac
gaattcttccgcaccggcacgtaccgcgtgcgttcggctgcccagacgtatcacacgtcc
agccccagcatggacatcagcaaggcgtcgaacttcgagcgcttcgtgttcgacctgttg
gatcgtgatccggcgcgcctcgcgcaactcttccgcgacgtggacgaaaagggcggcttt
tcgatgacgggcaagccggagttcgaccgcatcgccgagttcggctttgtctcgggccgc
agctcgcacgaagaccgcgtcgatacgatccgcgatgtgtttgccacctacggcaccatg
atcgacacccacactgccgatggcgtgaaagtggcgcgcgagaacctgacgccgggcgtg
ccgatggtggtgctggaaacggcgctgccggccaaatttggcgacaccattcgcgaagcg
ctggaccgcgagccggaacgtccggctggctacgccgatatcgaatcgctgccgcagcgc
ttcgaagtcatgccggcagacgctgaccgcatcaaggtctatatcgcccagcacaccggt
ctttaa

DBGET integrated database retrieval system