KEGG   Ralstonia pickettii 12J: Rpic_1236Help
Entry
Rpic_1236         CDS       T00762                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rpi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rpi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rpi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1323699..1325279
Genome map
AA seq 526 aa AA seqDB search
MALTLPQGMEIKAEILPAYEDILTPEALALVAKLHRAFQPRRKELLAARVERAKRLDAGE
RPDFLPETKAVREGDWKVAPIPPALHCRRVEITGPVDAKMVINAFNSGADSYMTDFEDSN
SPSWHNQIQGQVNLKAAIRRTLTLEQNGKTYKLNDKIATLQVRPRGWHLDEKHVLIDGER
VSGGIFDFALFLFHNAKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAKVTM
TSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIIGDKKRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFEKQRPDVEVKAADLLDFQPETPITEAGLRMNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKETGAVGHFDRAAVIFEQMSTSEDFAEFLTLPLYEEI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgctgccccaaggcatggagatcaaggctgagattctgccggcctatgaa
gacattctgacccccgaagcgctggcgctggtcgccaagctgcaccgtgccttccagccg
cgtcgtaaagagctgctggctgcccgtgtcgagcgcgccaagcgcctggacgccggcgag
cgcccggatttcctgccggaaaccaaggccgtgcgtgaaggcgactggaaggttgctccg
atcccgccggcactgcattgccgccgcgtggaaatcaccggcccggtcgatgccaagatg
gtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgaagattcgaat
tcgccgagctggcacaaccagatccagggccaggtcaacctgaaggctgccattcgccgc
acgctcacgctggagcagaacggcaagacctacaagctcaacgacaagatcgccacgctg
caggtgcgtccgcgcggctggcatctggacgagaagcatgtgctgatcgacggcgagcgc
gtgtccggcggcatcttcgactttgcgctgttcctcttccacaacgcaaaggagcagatc
gcgcgtggcgccggcccgttcttctacctgccgaagatggaaagccatctggaagcgcgc
ctttggaacgacatcttcgtgatggcacagaacgagatcggcctgccgcaaggcacgatc
aaggccactgtgctgatcgaaaccatcctcgccgcgttcgagatggaagaaatcctgtac
gaactgcgtgagcacagcgcaggcctgaatgccggccgttgggactacatcttctcgtgc
atcaagaagttcaaggtcgacaagaacttctgcctggccgatcgcgccaaggtgacgatg
acctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgcggt
gcgcccgccatcggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggccggcatcatcggcgacaagaagcgcgatgcgaccgacggctacgat
ggcggctgggtggcgcacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgacaagccgaaccagttcgagaagcaacgcccggacgtggaagtgaaggctgcg
gacctgctggacttccagccggaaacgccgatcaccgaagctggcctgcgcatgaacatc
aacgtcggcatccactacctgggtgcctggctggccggcaacggttgcgtgccgatccac
aacctgatggaagacgccgccacggcggaaatctcccgctcgcaggtgtggcagtggatc
cgctcgcccaagggcaagctggaagacggcaccaaggtcacggccgaactggtgcgcaag
ctgatcccggaagaattggccaaggtgaaggagacgggcgcggtgggccactttgaccgc
gctgcagtgatcttcgaacagatgtcgacgtcggaagactttgcggaattcctgaccctg
ccgctgtacgaagaaatctaa

DBGET integrated database retrieval system