KEGG   Ralstonia pickettii 12J: Rpic_1236Help
Entry
Rpic_1236         CDS       T00762                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic_1236
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic_1236
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic_1236
Enzymes [BR:rpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rpic_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1323699..1325279
Genome map
AA seq 526 aa AA seqDB search
MALTLPQGMEIKAEILPAYEDILTPEALALVAKLHRAFQPRRKELLAARVERAKRLDAGE
RPDFLPETKAVREGDWKVAPIPPALHCRRVEITGPVDAKMVINAFNSGADSYMTDFEDSN
SPSWHNQIQGQVNLKAAIRRTLTLEQNGKTYKLNDKIATLQVRPRGWHLDEKHVLIDGER
VSGGIFDFALFLFHNAKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKVDKNFCLADRAKVTM
TSPFMRAYALLLLKTCHKRGAPAIGGMSALIPIKNDPEKNAIAMAGIIGDKKRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFEKQRPDVEVKAADLLDFQPETPITEAGLRMNI
NVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKETGAVGHFDRAAVIFEQMSTSEDFAEFLTLPLYEEI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgctgccccaaggcatggagatcaaggctgagattctgccggcctatgaa
gacattctgacccccgaagcgctggcgctggtcgccaagctgcaccgtgccttccagccg
cgtcgtaaagagctgctggctgcccgtgtcgagcgcgccaagcgcctggacgccggcgag
cgcccggatttcctgccggaaaccaaggccgtgcgtgaaggcgactggaaggttgctccg
atcccgccggcactgcattgccgccgcgtggaaatcaccggcccggtcgatgccaagatg
gtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgaagattcgaat
tcgccgagctggcacaaccagatccagggccaggtcaacctgaaggctgccattcgccgc
acgctcacgctggagcagaacggcaagacctacaagctcaacgacaagatcgccacgctg
caggtgcgtccgcgcggctggcatctggacgagaagcatgtgctgatcgacggcgagcgc
gtgtccggcggcatcttcgactttgcgctgttcctcttccacaacgcaaaggagcagatc
gcgcgtggcgccggcccgttcttctacctgccgaagatggaaagccatctggaagcgcgc
ctttggaacgacatcttcgtgatggcacagaacgagatcggcctgccgcaaggcacgatc
aaggccactgtgctgatcgaaaccatcctcgccgcgttcgagatggaagaaatcctgtac
gaactgcgtgagcacagcgcaggcctgaatgccggccgttgggactacatcttctcgtgc
atcaagaagttcaaggtcgacaagaacttctgcctggccgatcgcgccaaggtgacgatg
acctcgccgttcatgcgcgcctacgcgctgctgctgctcaagacctgccacaagcgcggt
gcgcccgccatcggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggccggcatcatcggcgacaagaagcgcgatgcgaccgacggctacgat
ggcggctgggtggcgcacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgacaagccgaaccagttcgagaagcaacgcccggacgtggaagtgaaggctgcg
gacctgctggacttccagccggaaacgccgatcaccgaagctggcctgcgcatgaacatc
aacgtcggcatccactacctgggtgcctggctggccggcaacggttgcgtgccgatccac
aacctgatggaagacgccgccacggcggaaatctcccgctcgcaggtgtggcagtggatc
cgctcgcccaagggcaagctggaagacggcaccaaggtcacggccgaactggtgcgcaag
ctgatcccggaagaattggccaaggtgaaggagacgggcgcggtgggccactttgaccgc
gctgcagtgatcttcgaacagatgtcgacgtcggaagactttgcggaattcctgaccctg
ccgctgtacgaagaaatctaa

DBGET integrated database retrieval system