KEGG   Ralstonia pickettii 12J: Rpic_1709Help
Entry
Rpic_1709         CDS       T00762                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rpi00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1800860..1802374
Genome map
AA seq 504 aa AA seqDB search
MRNPRHRASLAVRRMGIETQQEYVVYMHRDCHVCRSEGFEAQTRVLISLNGRSIIATLNV
VDPTLLELGEAALSNSAWRALAPAPGDRITISHAPTLDSMSQVRAKIYGHRLDASALDSI
ISDVAAGSYPGTHIAAFLSACAGGRMDLQETIDLTRAMLAAGKRLDWGHAPIADKHCVGG
LPGNRTTPIVVSIITAAGLTMPKTSSRAITSPAGTADVIETMTPVALDLEQMRRVVQREG
GCFVWGGSLALSPADDMLIRVERPLDLDSDAQLVASVLSKKIAAGATHSVIDVPVGPTAK
VRSDADYECLKQMLEQVAQAFDLHLQVVRTDGTQPVGRGIGPSLEAHDVLAVLQRAERAP
EDLSVRAVALAGQLLEFCGHSEPGTGVLVAQRLLDSGAAWAKFQAICKAQGGLREPQRAR
LREPVLAERDGMVREIDSRRLARVAKLAGAPKAPAAGLELHVKLGDRVERGMPLFTVHAE
ALGELDYAFDYLEAHPLIDVGDSR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaccctcgccacagggcaagtcttgccgtgcgtcggatgggcatcgagacgcag
caggaatatgtcgtctacatgcatcgagactgccatgtttgccgctccgagggtttcgag
gcgcagacgcgagtactgattagcctgaacggacgctcgatcatcgccacgctgaacgtt
gtcgatccgaccttgctggagttgggggaggcggcgctttcgaacagcgcgtggcgagcg
ctggcgcccgcgccgggcgaccggatcacgatctcgcatgccccgacgctggactcaatg
agccaggtgcgggcgaagatctacggccacaggctcgacgcgtcggctctggactcgatc
attagtgacgtcgccgctggcagctaccctgggacacatatcgccgcttttctaagcgcc
tgcgccggcgggcggatggatttgcaggagacgatcgatctgacgcgagcgatgctggcc
gcgggcaagcggctcgactgggggcatgcaccgatcgcggacaagcactgtgtgggtgga
ttgccgggaaaccgcacgacgccgattgtcgtgtcgatcatcaccgcggccgggctcacg
atgccgaagacgtcgtcaagggccattacctcgccggctggcaccgccgacgtgatcgaa
acgatgacgccggtggcgctcgatttggagcagatgcgccgcgttgtccaacgcgagggc
ggctgctttgtctggggaggctcgctggcgctcagcccggccgacgacatgttgatccgc
gtcgagcgcccgctggacctcgacagcgacgcgcagctcgtggcatctgtgctgtcgaag
aagatcgctgccggcgctacccactccgtgatcgatgtgccggtcgggccgaccgccaag
gtgcgcagtgacgcagactacgagtgcctgaagcaaatgctggagcaggtagcgcaggcc
tttgatttgcacttgcaggtagtgcgtacggacgggacgcagccggtgggccgtggcatt
ggtccctcactggaggcgcacgacgtgctggcagtccttcagcgtgccgagcgcgcgccc
gaggatctgagcgtgcgcgctgtcgcattggctggacaactgttggaattttgcggtcac
agcgagccgggtactggcgtcttggtcgctcagcggttgcttgatagcggcgccgcgtgg
gccaaattccaggcgatctgcaaagcgcaagggggcttacgcgagccgcagcgggcgcgg
ctacgcgagcctgtgctggccgaacgtgacgggatggtacgtgagatcgacagccggcgg
ttggctcgcgtggccaagctcgccggggcaccgaaggcacccgctgccgggctcgaactg
catgtcaagctgggggatcgcgtcgagcgaggtatgccgctgttcaccgtgcatgccgaa
gcgctcggcgagttggactacgcgttcgactacctggaggctcacccgctgatcgatgtg
ggagattcgagatga

DBGET integrated database retrieval system