KEGG   Ralstonia pickettii 12J: Rpic_1791Help
Entry
Rpic_1791         CDS       T00762                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
rpi  Ralstonia pickettii 12J
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rpic_1791
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rpic_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1885419..1886093
Genome map
AA seq 224 aa AA seqDB search
MVRRLGIRAITVTLVSLVFSASALAESDLARGAQAARACMACHSFAPGRHMTGPSLAGVL
GRKAGTADGFARYSDALKQSGLVWDKRNLDAWLKNPAALVSGNAMTFPGIADARTRADLI
AYLEAVSTGRVKVPDRGLPNLKESDAASRVTSIRFCDDAYRLTTADRKTHAFWEFNLRFK
TDGSAAGPAAGQPVLIGTGMQGDRAAVVFARPEEISAFIQRRCP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggttcgacgacttggtattcgagcgatcacggtcaccttggtctcacttgtctttagc
gcgtcagctcttgccgagagtgacctcgcgcgcggcgcgcaagccgcccgcgcctgcatg
gcgtgccattcatttgcgccaggccgccacatgacaggcccgagcttggcgggcgttttg
ggccgcaaagcaggtacagcggacggtttcgcgcgctattccgatgccctcaagcaatca
ggcctggtctgggacaagcgaaacctcgatgcatggctcaagaatccggcagcgctggtg
tcgggtaacgcgatgacctttcccggcattgccgatgcacgcacgcgggccgatctgatc
gcctaccttgaggcagtttccacgggtcgcgtaaaggttcctgatcgtggcctgccgaat
ttgaaggagtccgatgcggcgtcgcgggttacctcaatccgcttttgtgacgatgcctat
cgcctcaccaccgccgaccggaagactcacgccttttgggagttcaacctgcgattcaaa
accgatggcagcgctgccggcccggctgccggtcagcctgtgctgatcggcacaggcatg
cagggcgaccgcgccgccgtggttttcgcacgccccgaagaaatctctgccttcattcag
aggcggtgtccataa

DBGET integrated database retrieval system