KEGG   Ralstonia pickettii 12J: Rpic_1863Help
Entry
Rpic_1863         CDS       T00762                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rpic_1863
Enzymes [BR:rpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rpic_1863
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rpic_1863
Lipid biosynthesis proteins [BR:rpi01004]
 Fatty acid synthase
  Component type
   Rpic_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1961306..1961923
Genome map
AA seq 205 aa AA seqDB search
MFSMLPLAQAAAAEGAPASHRVVVLGDSLSAGYGLAQGTGWVALLDRRLKERKPDYSVAN
ASISGDTTAGGRSRLPAVLAREKPSVVILELGGNDALRGLSLASSEGNMKAMIEASQAAG
AKVLLVGMRIPPNYGPDYSERFFAMFGKLAQQYKLPLVPFLLEGVAQRPDWFQEDRIHPI
AAAQPTMLDNVWPKLEPLLKARVGR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcatgctgccgctcgcacaggccgctgcagcagaaggcgcgccggcatcgcat
cgtgtggtggtgctgggtgacagcctgtcggcgggatacggcctggcgcaaggcacaggc
tgggtcgcgttgctcgacaggcgcctcaaagaacggaagcccgattatagcgtcgccaat
gcaagcatcagcggcgacaccacggccggcggccgctcgcgcttgcccgccgtgctggcc
cgcgaaaagccctctgtcgtgattctcgaactgggcggtaacgacgcgctgcgcggcctg
tcgctcgcctccagcgagggcaacatgaaggcgatgatcgaagcatcgcaagcggctggc
gcgaaggtgctgctggtgggcatgcgcatcccgccgaactacggcccggattacagcgag
cgcttcttcgccatgttcggcaagctggcgcagcagtacaagctgccactggtgccattc
ctgctcgaaggggttgcgcagcggcccgactggttccaggaagatcgcatccaccccatt
gccgcagcgcagccgacgatgctcgataacgtgtggcccaaactggaacctctccttaaa
gcccgggtcggaagatga

DBGET integrated database retrieval system