KEGG   Ralstonia pickettii 12J: Rpic_1946Help
Entry
Rpic_1946         CDS       T00762                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00010  Glycolysis / Gluconeogenesis
rpi00020  Citrate cycle (TCA cycle)
rpi00620  Pyruvate metabolism
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01200  Carbon metabolism
Module
rpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_1946
   00020 Citrate cycle (TCA cycle)
    Rpic_1946
   00620 Pyruvate metabolism
    Rpic_1946
Enzymes [BR:rpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rpic_1946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA HlyD_D23 DEC-1_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACD27081
UniProt: B2UFY0
Position
1:complement(2052360..2054033)
Genome map
AA seq 557 aa AA seqDB search
MSQVVEIKVPDIGDYKDVPVIEVLVKAGDTVNAEDSLVTLESDKATMDVPSPKSGVVKEV
KIKVGDTVSEGSLVLLLEEQGAAAAPAPAPQAAPAPAPAAAAPAPAPAAQAPAPAPAAAG
GGTVEVKVPDIGDYTDVPVIEISVKVGDRVEAEQSLITLESDKATMDVPSPAAGTVKEIR
VKVGDAVSQGTLIVVLEGAGGAAAAPAPAQAPVSAPAAAAPSPAPAAAPAVASTAAPATY
TADTVGTVGKAAHASPSVRKYARELGVNVNLVGGTGPKNRITQEDVQRYVKGVMSGQAAA
PGKAAAGAPAGGGELNLLPWPKVDFTKFGPVDPKPLSRIKKISGANLHRNWVMIPHVTNN
DEADITELEAFRVQMNKDHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLVFKQY
FHVGFAADTPNGLVVPVIRDADKKGLIDIAKEMADLSKAAREGKLKPDQMQGGCFSISSL
GGIGGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAAR
FNAYLASVLADFRRVSL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtcgtagaaatcaaggtgccggacatcggcgactacaaagacgtcccggtg
atcgaagtgctggtcaaggcgggcgataccgtcaacgccgaagattcgctggttacgctg
gaatcggacaaggcgaccatggacgtgccctcgcccaagagcggcgtcgtcaaggaagtg
aagatcaaggtgggtgacaccgtgtcggaaggctcgctggtgctgttgctcgaagagcag
ggcgctgctgccgcaccggccccggcacctcaagctgcgcccgcaccggctccggccgct
gctgcaccggcgcccgcacccgccgcgcaagctccggcccctgcgccggctgccgctggc
ggcggcacggttgaagtgaaggtgccggacatcggcgactacaccgacgtgcccgtcatc
gaaatcagcgtgaaggtgggcgacagggtggaagccgagcagtcgctgatcacgctggaa
tcggacaaggccacgatggacgtgccgtcgccggctgccggcacggtcaaggaaatccgc
gtgaaggtgggcgatgccgtgtcgcaaggcacgctgatcgtcgtcctggaaggtgctggc
ggcgctgctgctgcgccagcacccgcacaagcgccggtgtccgcaccggctgccgctgcg
ccgagcccggcccctgcggctgcgcccgcagttgcgtcgaccgcagcgcccgctacctac
accgctgacacggtcggtacggttggcaaggctgctcacgccagcccctcggtgcgcaag
tacgcgcgcgagctgggcgtcaacgtgaatctggtcgggggcacgggtccgaagaaccgc
atcacgcaggaagacgtgcagcgctacgtcaagggcgtgatgagcggccaggctgcggcg
ccgggcaaggctgccgcgggtgcaccggccggtggcggtgagttgaatctgctgccgtgg
ccgaaggtggacttcaccaagttcggtccggtcgatccgaagccgctgtcgcgtatcaag
aagatttccggcgcgaacctgcaccgcaactgggtcatgattccgcacgtcaccaacaac
gacgaggcggacatcaccgaactggaagccttccgcgtgcagatgaacaaggaccacgaa
aaggccggcgtgaagttcacgatgctggcattcgtgatcaaggcagtcgtgggcgcgctg
aagaaattcccgaccttcaacgcgagcctggacggcgacaacctggtcttcaagcagtac
ttccacgtcggcttcgcggccgatacgcccaacgggctcgtggtgccggtgatccgcgat
gcggacaagaagggtctgatcgacatcgccaaggagatggcggacctgtcgaaggctgcc
cgcgaaggcaagctcaagccggaccagatgcaggggggctgcttctcgatctcgtcactg
ggcggcatcggcggcacgcatttcacgccgatcatcaacgcaccggaagtggccatcctt
ggcttgtcgcgtggttatcagaagcccgtttgggacggcaagcagttcgtgccgcgcctg
acgctgccgctgtcgctgtcgtacgatcaccgcgtgatcgacggcgccgaggctgcacgc
ttcaacgcgtatctggccagcgtgctggcggacttccgccgcgtcagcctgtaa

DBGET integrated database retrieval system