KEGG   Ralstonia pickettii 12J: Rpic_2028Help
Entry
Rpic_2028         CDS       T00762                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpic_2028
Enzymes [BR:rpi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rpic_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2134901..2135698)
Genome map
AA seq 265 aa AA seqDB search
MGILNVTPDSFSDGGRHATRDAALRHAEQLITEGVDMIDIGGESSRPGAEPLSLQAELDR
VMPIVEALRECGKPLSIDTYKPEVMRATLDAGADLINDIWGFRRPGAIEAVAKGNAGLCV
MHMQRDPETMQEAPSYVDLMGEVEAFLCTQTEALMAAGVAAERVSLDPGFGFGKTPDHNL
TMLNRLAEFQRIGLPLLAGLSRKSTLGAVLGGKPPAERVTVSVAAALLAAERGAFIVRVH
DVQPTLEAIQLWWAMRHERVNPPMA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggcattctcaacgtcacgcccgattcgttctccgatggcgggcggcacgccacgcgt
gatgcagcgttgcgccacgccgagcagctgatcaccgaaggcgtcgacatgatcgacatc
ggtggagagtcgagccggccgggcgccgagccgttgagcctgcaagccgagttggaccgg
gtgatgcccatcgtcgaggcgctacgcgaatgcggcaagccgctgtcgatcgatacctac
aagcccgaggtgatgcgggccacgctggatgcgggcgccgatttgatcaacgatatctgg
ggttttcgccggcctggcgcgatcgaggcggtggcaaagggcaacgcgggcctgtgtgtc
atgcatatgcagcgcgatcccgaaacgatgcaggaagcgcccagctatgtagacctgatg
ggcgaggtggaggccttcctgtgcacgcagacggaggcgctgatggctgccggcgtggcg
gccgagcgtgtctcccttgatccggggtttggttttggcaagacgccggatcacaacctc
accatgctcaatcgcttggcggagtttcagcgcatcggtttgccgctgctcgccggtttg
tcgcgcaaatcgacgctgggcgcggtgttgggcggcaaaccgccagccgaacgtgtgacc
gtcagtgtggcggcagcgctactggcggcggagcggggcgcgttcatcgtgcgtgtgcac
gacgtgcagccgaccttggaggcaattcaactctggtgggccatgcgtcatgaacgcgta
aatccgccaatggcctga

DBGET integrated database retrieval system