KEGG   Ralstonia pickettii 12J: Rpic_2137Help
Entry
Rpic_2137         CDS       T00762                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rpic_2137
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic_2137
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpic_2137
Enzymes [BR:rpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rpic_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2247431..2248624)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDAHGHFGPYGGTFVAETLSHALDELRDAYARYQHDPEFIKEYEYELKHFVGRPSP
IYHARRLTEHCGGAQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGAGQHGV
ATATIAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVADTFYIIGTVAGPHPYPMMVRDFQAVIGEECKVQMPEMTGRQPDAVIACVGGGSNA
MGIFYPYIDHADVKLIGVEAAGEGIETGRHAASLMGGSPGVLHGNRTYLLQDEDGQIIET
HSISAGLDYPGVGPEHAWLKDVQRAEYVGITDKEALQSFHDLCRMEGIIPALESSHALAY
ACKLAPTLPKDKILLVNLSGRGDKDMHTVAELSGIQL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctgcccgacgcccacggccattttggcccctacggcggcaccttcgttgcg
gaaacgctgtcccacgcgctggatgaattgcgcgacgcctatgcgcgctaccagcacgat
cccgagttcatcaaggaatacgaatacgagctgaagcacttcgtcggccgtccgtcgccc
atctatcacgcacgccgcctgaccgaacactgcggcggcgcgcagatctacctcaagcgc
gaagacctgaaccacaccggcgcgcacaaggtgaacaacgtgattggccaggcgctgctg
gcacgccgcatgggcaagccacgcgtgattgcggaaacgggggccggccagcacggcgtg
gccaccgccacgatcgcggcgcgttacggcatggagtgcgtcgtctacatgggcagcgaa
gacgtgcgccgccaggccgccaacgtctaccgcatgaagctgctgggcgcgaccgtggtg
cccgtggagtcgggctcgcgcacgctcaaggacgcgctgaacgaagcgatgcgcgactgg
gtgaccaacgtggccgacaccttctacatcatcggcacggtggcgggcccgcacccgtat
ccgatgatggtgcgcgacttccaggccgtgatcggcgaggaatgcaaggtgcagatgccc
gagatgaccggacgccagccggacgccgtgatcgcctgcgtgggcggcggctccaacgcc
atgggcatcttctatccgtacatcgatcatgccgacgtcaagctgatcggcgtggaagca
gcgggcgagggcatcgagaccggccgccacgccgcgtcgctcatggggggctcaccgggc
gtgctgcacggtaaccgcacctatctgctgcaggatgaggacggccagatcatcgagacg
cattcgatttcggcggggctggactatccgggcgtcggtccagaacacgcctggttgaag
gatgtgcagcgcgcggaatacgtcggcattaccgacaaggaggcgctgcagtctttccat
gacctgtgccgcatggagggcatcatcccggcgctggaatcgagccacgcactggcgtat
gcgtgcaagctggcgccgacactgcccaaggacaagatcctgctggtgaacctctcgggc
cgaggcgacaaggatatgcatactgtcgctgaactctccggcatccaactctaa

DBGET integrated database retrieval system