KEGG   Ralstonia pickettii 12J: Rpic_2150Help
Entry
Rpic_2150         CDS       T00762                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00020  Citrate cycle (TCA cycle)
rpi00190  Oxidative phosphorylation
rpi00650  Butanoate metabolism
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01200  Carbon metabolism
Module
rpi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpic_2150
   00650 Butanoate metabolism
    Rpic_2150
  Energy metabolism
   00190 Oxidative phosphorylation
    Rpic_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACD27284
UniProt: B2U702
Position
1:complement(2262779..2263144)
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDFLAQRVTAVIMAVYTVVLLAAFLLSKDTSYQSWAGLFSN
QWMKMLTFLAFVSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataacaatattggtcccaagcgcctcgttgtgggcgcgcactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtgatcatggcggtctacaccgtcgtgctgctg
gcggcgttcctgctctcgaaagacacgtcgtaccaaagctgggcggggctgttctccaac
cagtggatgaagatgctgacgttcctggcgttcgtgtcgctcacgtatcacgcctggatc
ggtgtgcgtgacatctggatggactacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgtgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system