KEGG   Ralstonia pickettii 12J: Rpic_2216Help
Entry
Rpic_2216         CDS       T00762                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rpic_2216 (tpiA)
   01230 Biosynthesis of amino acids
    Rpic_2216 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic_2216 (tpiA)
   00051 Fructose and mannose metabolism
    Rpic_2216 (tpiA)
   00562 Inositol phosphate metabolism
    Rpic_2216 (tpiA)
Enzymes [BR:rpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rpic_2216 (tpiA)
Exosome [BR:rpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rpic_2216 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rpic_2216 (tpiA)
  Exosomal proteins of melanoma cells
   Rpic_2216 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2325425..2326171)
Genome map
AA seq 248 aa AA seqDB search
MNARPKLVVGNWKLHGSLSTNAALLEQIKAAGKTNATLAVCVPFPYLAQCQSLLAGSAVG
WGAQDVSAETRGAFTGEVAASMLSEFGCGYAIVGHSERRSYHGETDAQVATKALRALEHG
ITPIVCVGETLAQREAGETEQVVARQLDAVLEALSVEQLGRIVVAYEPVWAIGTGKTATS
EQAQAVHAFLRARVAARDAGVAQRLSILYGGSVKPDNAGELFAMADIDGGLIGGASLKAE
DFLAIGRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcaagaccgaagctggtggtgggcaactggaagctgcatggcagtctgagcacg
aacgccgcgctgcttgaacagatcaaagcggcaggcaaaaccaacgccacgctggccgtg
tgtgtgccgttcccgtacctggcccagtgccagtccttgctcgccggttctgcagtcggc
tggggcgcgcaggatgtgtcggctgaaacgcggggcgcctttaccggcgaagtggcggcg
tcgatgctgtcggagtttggctgcggctacgcgatcgtcggtcactccgagcgtcgctcg
taccatggcgaaaccgatgcgcaagtggcgaccaaggcgctgcgtgcactggaacatggc
attaccccgatcgtctgtgtgggcgaaacgctcgcgcaacgtgaagcaggtgagaccgag
caggtggtcgcccgccaactcgatgcagttctcgaagcgctgtcggtcgagcaacttggt
cgtatcgtcgtggcgtatgagccggtttgggccattggcacgggcaagaccgcgacgagc
gagcaggcgcaggctgtgcacgcgtttctgcgcgcacgtgttgctgcccgcgacgctggc
gtggcgcagcgtctgtcaattctgtacggtggcagcgtcaagcccgacaatgccggcgaa
ttgtttgcaatggcggacatcgatggcggcctgatcggcggcgcatcgttgaaggcagaa
gatttcctggcgatcgggcgcgcataa

DBGET integrated database retrieval system