KEGG   Ralstonia pickettii 12J: Rpic_2276Help
Entry
Rpic_2276         CDS       T00762                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00230  Purine metabolism
rpi01100  Metabolic pathways
Module
rpi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rpic_2276
Enzymes [BR:rpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rpic_2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 ABC_tran AAA_22 AAA_16 AAA_29 AAA_25 Septin cobW AAA_23 Dynamin_N AAA_18 AAA_30 GTP_EFTU
Motif
Other DBs
NCBI-ProteinID: ACD27410
UniProt: B2U8D4
Position
1:complement(2396450..2397115)
Genome map
AA seq 221 aa AA seqDB search
MPSSQAHSAVDTPIENHFPGSLFMVVAPSGAGKSTLVNALLAQDSSIRLSVSATTRKPRP
GEQHGREYNFMTVEEFKACRDRGEFLEWAEVHGNYYATSRVWIEEQMRAGTDVLLEIDWQ
GAQQVHQRFSNAVEIFILPPSLPALEERLKKRGQDEPNVIVRRLLAAGSEMAHAPEADYV
IINEVFDTALAELRTVVQATRLRFGAQKARHGELFVELGIH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccatcctctcaagcgcactctgccgttgatacgcccatcgagaatcattttcccggc
agcctgttcatggtcgtggcaccgtccggcgccggcaagtcgacgctggtgaatgcgctg
ctggcgcaggattcgtcgattcgcctgtcggtctcagctacgacgcgcaagccgcgtccg
ggcgagcagcacggccgcgagtacaacttcatgaccgtcgaggagttcaaggcttgtcgt
gatcgcggcgagtttctcgaatgggccgaggtacacggcaactactacgccacttcgcgc
gtgtggatcgaagaacagatgcgcgccggcaccgacgtgctgctcgagatcgactggcag
ggcgctcaacaggtgcatcagcgtttttccaatgccgtcgaaatcttcatcctgccgccg
tcgctccctgcgctggaagaacgtctgaagaagcgcggtcaggacgagccgaatgtgatc
gtgcgccgcctgctggcggcgggctccgagatggcgcacgcgcccgaggccgactacgtg
atcatcaacgaagtgttcgataccgcattggccgaactgcgcaccgtggtgcaggccacg
cgcctgcgcttcggtgcccagaaggcgcgccacggcgagttgttcgtcgagctgggcatt
cactga

DBGET integrated database retrieval system