KEGG   Ralstonia pickettii 12J: Rpic_2442Help
Entry
Rpic_2442         CDS       T00762                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rpi  Ralstonia pickettii 12J
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rpic_2442
   00052 Galactose metabolism
    Rpic_2442
   00500 Starch and sucrose metabolism
    Rpic_2442
   00520 Amino sugar and nucleotide sugar metabolism
    Rpic_2442
Enzymes [BR:rpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rpic_2442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2552881..2553753
Genome map
AA seq 290 aa AA seqDB search
MQRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKAYELEAELEAKHKTALLEVVRSIKPSHVDCFYVRQPEALGLGHAVQCAEK
LVGDAPFAVILADDLLDGDPPVMKQMVDLYDHYNCSVIGVEEIDPVQSRSYGVVDGRPWE
EDGSVIKMSAIVEKPAPENAPSNLGVVGRYILTPRIFEHIRNLKPGAGGELQLTDAIQSL
LSAEQVLAYRYKGVRYDCGSKLGYLKATVELALKHKEVADEFRAYLAARG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgtcaccaaagccgttttccccgtcgcggggctcggcacacgattcctgccg
gccaccaaggccagcccgaaagaaatgctgccggtcgtggacaagccgctgatccagtac
gccgtggaagaagccatggccgccggcatcaccgagatgatcttcgtgaccggccgcagc
aagcgcgcaattgaagaccactttgacaaggcctacgagctggaagccgaactcgaagcc
aagcataagaccgcgctgctcgaagtcgtgcgctcgatcaagccgtcgcatgtggattgc
ttctacgtgcgccagcctgaagcgctgggcctcggccacgccgtgcaatgcgccgaaaag
ctcgtcggcgatgcgcccttcgcggtcatcctggcggacgacttgctggacggcgacccg
cccgtcatgaagcagatggtcgacctgtacgaccactacaactgctcggtgatcggcgtg
gaagaaatcgaccccgtgcagagccgctcgtacggcgtggtcgatggccgcccgtgggaa
gaagacggcagcgtgatcaagatgtcagctatcgtcgagaagccggcaccggaaaatgcg
ccgtccaacctcggcgtggtcggccgctacatcctcacgccgcgcattttcgaacacatc
cgcaacctcaagccgggcgccggcggcgagttgcagctgacggatgccatccagtcgctg
ctgtcggccgagcaggtgctggcctatcgttacaagggcgtgcgctacgactgcggtagc
aagctggggtacctgaaggcaacggtggaactggcgctcaagcacaaggaagttgctgac
gaattccgtgcctatctggctgcacgcggctga

DBGET integrated database retrieval system