KEGG   Ralstonia pickettii 12J: Rpic_2628Help
Entry
Rpic_2628         CDS       T00762                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00071  Fatty acid degradation
rpi00280  Valine, leucine and isoleucine degradation
rpi00281  Geraniol degradation
rpi00310  Lysine degradation
rpi00360  Phenylalanine metabolism
rpi00362  Benzoate degradation
rpi00380  Tryptophan metabolism
rpi00410  beta-Alanine metabolism
rpi00627  Aminobenzoate degradation
rpi00640  Propanoate metabolism
rpi00650  Butanoate metabolism
rpi00903  Limonene and pinene degradation
rpi00930  Caprolactam degradation
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01212  Fatty acid metabolism
Module
rpi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpic_2628
   00650 Butanoate metabolism
    Rpic_2628
  Lipid metabolism
   00071 Fatty acid degradation
    Rpic_2628
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpic_2628
   00310 Lysine degradation
    Rpic_2628
   00360 Phenylalanine metabolism
    Rpic_2628
   00380 Tryptophan metabolism
    Rpic_2628
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpic_2628
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rpic_2628
   00281 Geraniol degradation
    Rpic_2628
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic_2628
   00627 Aminobenzoate degradation
    Rpic_2628
   00930 Caprolactam degradation
    Rpic_2628
Enzymes [BR:rpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rpic_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACD27754
UniProt: B2UA60
Position
1:complement(2741476..2742261)
Genome map
AA seq 261 aa AA seqDB search
MSEASEVLVSRDGAIATLTINRPRAKNSLNRAVFDGLRAQLVQLRDDDTVRAVIITGAEG
VFCAGADITAFDALRAEPLLGDRAAAGGHFWSELERFPKPVIAAVEKLALGGGTELALAC
DIAIAGESANFGVPEVKLGAIPGAGGTQRLIHAIGKSKAMALLLTGDFIDARKACDAGMV
AEVTADGQALPTALAMANRIAANSPLAVALAKDAALASFETPLAQGLEHEKRNFLVALRS
ADNLEGQAAFLGKRTPHFTGQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccagcgaagtgctcgtcagccgcgatggcgccatcgccaccttgaccatc
aaccgcccgcgcgcgaagaacagcttgaaccgcgcggtattcgatggcctgcgtgcgcag
cttgtgcaactgcgcgacgacgataccgtgcgcgcggtcatcatcaccggcgccgagggc
gtgttctgcgccggggccgacatcacggccttcgatgcgctgcgcgccgagccactgctg
ggcgatcgtgcggcagcaggcggccacttttggtcggaactggagcgcttccccaagccc
gtcatcgcagcggtggaaaagctcgcgctgggcggcggcacagaattagcgctggcctgc
gacatcgcgatcgctggcgagtctgccaattttggtgtgccggaagtcaagctgggcgcc
attccgggtgccgggggcacgcagcgcctgatccacgctatcggtaagtccaaggccatg
gccctgttgctgaccggcgatttcatcgacgcccgcaaggcttgcgatgcaggcatggtc
gccgaagtgacggctgatggccaggccctgccgacggcgttggcgatggccaaccggatt
gcagccaattcgccgctggccgtggcgctggcgaaagatgcggcactggccagctttgag
actccgctcgcgcaaggcctggagcatgagaagcgtaatttcctcgtcgctttgcgttcg
gccgacaacctggaagggcaagcggcattcctgggcaagcgcaccccccacttcacgggc
caataa

DBGET integrated database retrieval system