KEGG   Ralstonia pickettii 12J: Rpic_2718Help
Entry
Rpic_2718         CDS       T00762                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi01040  Biosynthesis of unsaturated fatty acids
rpi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rpic_2718
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Rpic_2718
Lipid biosynthesis proteins [BR:rpi01004]
 Desaturase
  First
   Rpic_2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: ACD27843
UniProt: B2UAP6
Position
1:complement(2831283..2832473)
Genome map
AA seq 396 aa AA seqDB search
MIDSFLTFLANGTLDWAWWQILIFTLVMTHITIASVTIFLHRCQAHRALDVHPIAGHFFR
FWLWLTTGMVTKEWTAIHRKHHAKCETEEDPHSPQTRGIRKVLMEGAELYRAEAKNKETI
QKFGHGTPDDWVEKNVYSKFTWQGVGLMLILDVLMFGALGLTVWAVQMLWIPIHAAGIIN
GLGHFWGYRNFDCEDASTNVSPWGIIIGGEELHNNHHTYATSAKFSVKWYEFDIGWGYIR
ALEIVGLAKVKKVAPKARFGDVKPVDQNTLEAIIANRYDVMARYAKTVKAAYRQELAKLK
DSRAVEYRALKPARKWFHRDETKLGAPQREQLSQIVSDHSALHTFVEMRRELGALWGRSN
ATREQLLYQLQEWCKRAEESGIHALQEFAVRLRRYA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgactcctttctgactttccttgccaacggcaccctggattgggcctggtggcag
atcctgattttcacgctggtgatgacgcacatcacgatcgccagcgtcacgatttttctg
caccgctgccaggcgcaccgtgcgctggacgtgcatcccatcgccggacacttcttccgt
ttctggctgtggctaaccacgggcatggtcaccaaggaatggaccgccattcaccgtaag
caccacgccaagtgcgaaaccgaagaggatccgcacagcccgcagacccgaggcatccgc
aaggtgctgatggaaggcgcggagctgtatcgcgctgaggccaagaacaaggaaacgatc
cagaagttcggccacggtacgccagacgattgggtcgagaagaacgtgtattcgaagttc
acgtggcagggcgtcggtttgatgctgatcctggacgtgctgatgttcggcgcgctgggc
ctcacggtgtgggcggtgcagatgctgtggattccgatccacgctgccggcatcatcaat
ggtttgggccacttctggggctaccgcaacttcgactgcgaagacgcttcgaccaacgtg
tcgccgtggggcatcatcatcggcggcgaagaactgcacaacaaccaccacacgtacgct
acgtcggccaagttttcggtcaagtggtacgagttcgatatcggctggggctacatccgc
gcgctggaaatcgtcggtttggcgaaagtcaagaaagtggcgcccaaggcccgttttggc
gacgtgaagccggtcgaccagaacacgctggaagccatcatcgccaaccgctacgacgtg
atggcccgctacgcgaagaccgtcaaggcggcctaccgccaggagctggccaagctgaag
gactcgcgcgctgtcgagtaccgcgcactcaagccggcccgcaagtggttccaccgcgac
gagacgaaactgggcgcgccgcagcgcgagcagctctcccaaatcgtgtcggaccattcg
gcgctgcacaccttcgttgagatgcgccgtgagcttggcgccctgtggggccgatcgaac
gccacgcgtgagcaactgctgtatcagctgcaagagtggtgcaagcgtgctgaggaaagc
ggtatccacgcgctgcaggaatttgctgtgcgcctgcgccgttacgcctga

DBGET integrated database retrieval system