KEGG   Ralstonia pickettii 12J: Rpic_2910Help
Entry
Rpic_2910         CDS       T00762                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00480  Glutathione metabolism
rpi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rpic_2910
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rpic_2910
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rpic_2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ACD28033
UniProt: B2UBT3
Position
1:complement(3023397..3023894)
Genome map
AA seq 165 aa AA seqDB search
MSDVYAFEADSLTGQRVPLSQYKGKVLLIVNTASKCGFTPQYAGLEAVYKRLHDKGLEVL
GFPCNQFGKQEPGGEDEIGAFCEKNYGVSFPMFGKIDVNGSNAHPLYKWLTSEKPGVLGI
GAIKWNFTKFLLRRDGTVYKRYAPMTKPEEIADDIERLLAEPDPA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtctatgcattcgaggccgattcgttaaccggccagcgcgtgccgctgtcg
cagtacaagggcaaggtcctgctgatcgtcaacacggcgagcaagtgcggattcacgccg
cagtacgcggggctggaggcggtgtacaagcggctgcacgacaaagggctagaggtgctc
ggctttccgtgcaaccagttcggcaagcaggaaccgggcggcgaagacgagatcggcgcc
ttctgcgaaaagaactacggcgtctcgtttccgatgttcggcaagatcgacgtgaatggc
tccaacgcgcatccgctctacaagtggctgacctcggaaaagcccggcgtgctcggtatc
ggagccatcaaatggaatttcaccaagttcctgctgcgccgcgacggcacggtctacaag
cgctacgcgcccatgaccaagccggaagagattgccgacgatattgagcggctgctggcg
gagcccgatcccgcctga

DBGET integrated database retrieval system